SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBL100C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YBL100C   Protein: S000000196
Sequence length 104
Comment YBL100C SGDID:S000000196, Chr II from 37300-36986, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; almost completely overlaps the 5' end of ATP1"
Sequence
MLFKPKTRAIPSPTARTLPVSFKLASSDTPLILSSKMEETSVGCALVEANLLVEAKAAAA
GLAALVELIRVLDRERIAAVRANIIICACFFYLFCYCSCDSYES
Download sequence
Identical sequences P38168
YBL100C YBL100C 4932.YBL100C YBL100C YBL100C YBL100C YBL100C YBL100C YBL100C YBL100C YBL100C YBL100C YBL100C YBL100C YBL100C YBL100C

Jump to [ Top of page · Domain architecture · Domain assignment details ]