SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBL109W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YBL109W   Protein: S000002150
Sequence length 111
Comment YBL109W SGDID:S000002150, Chr II from 5790-6125, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on experimental and comparative sequence data"
Sequence
MSLRPCLTPSSMQYSDIYIYPNTTLTLPYFNPSNLSLNLPSHYPTSPLVTLSHSTIPLPT
TIHPSTYYHQSTVHHNRYPPISHIQLHYHLPCHYSTIHHLLLTILLFYPPY
Download sequence
Identical sequences P89495
YBL109W YBL109W YBL109W YBL109W 4932.YBL109W YBL109W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]