SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBL109W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Most Informative Gene Ontologies

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YBL109W   Protein: S000002150
Sequence length 111
Comment YBL109W SGDID:S000002150, Chr II from 5790-6125, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on experimental and comparative sequence data"
Sequence
MSLRPCLTPSSMQYSDIYIYPNTTLTLPYFNPSNLSLNLPSHYPTSPLVTLSHSTIPLPT
TIHPSTYYHQSTVHHNRYPPISHIQLHYHLPCHYSTIHHLLLTILLFYPPY
Download sequence
Identical sequences P89495
YBL109W YBL109W 4932.YBL109W YBL109W YBL109W YBL109W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]