SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBL113W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YBL113W-A   Protein: S000028599
Sequence length 160
Comment YBL113W-A SGDID:S000028599, Chr II from 646-1128, Dubious ORF, "Dubious open reading frame unlikely to encode a protein; identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching"
Sequence
MMPAKLQLDVLRTLQSSARHGTQTLKNSNFLERFHKDRIVFCLPFFPALFFVPVQKVLQH
LCLRFTQVAPYFIIQLFDLPSRHAENLAPLLASCRIQYTNCFSSSSNGQVPSIISLYLRV
DLSPFYAKIFQISYRVPMIWLDVFQVFFVFLIISQHSLHS
Download sequence
Identical sequences Q8TGK5
YBL113W-A 4932.YBL113W-A YBL113W-A YBL113W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]