SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YBR019C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR019C
Domain Number 1 Region: 371-699
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.26e-92
Family Aldose 1-epimerase (mutarotase) 0.00000000000624
Further Details:      
 
Domain Number 2 Region: 12-355
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.33e-91
Family Tyrosine-dependent oxidoreductases 0.00000000000331
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
transferase complex 1.369 13.53
microbody 1.856 13.02
organelle envelope 1.405 12.26
side of membrane 1.633 12.26
oxidoreductase complex 1.828 7.82
Golgi membrane 1.639 6.7
cytosol 1.295 6.49
vacuolar part 1.567 6.4
endoplasmic reticulum subcompartment 1.59 5.61
nuclear outer membrane-endoplasmic reticulum membrane network 1.527 5.61

Protein sequence

External link(s) Locus: YBR019C   Protein: S000000223
Sequence length 699
Comment GAL10 SGDID:S000000223, Chr II from 278352-276253, reverse complement, Verified ORF, "UDP-glucose-4-epimerase, catalyzes the interconversion of UDP-galactose and UDP-D-glucose in galactose metabolism; also catalyzes the conversion of alpha-D-glucose or alpha-D-galactose to their beta-anomers"
Sequence
MTAQLQSESTSKIVLVTGGAGYIGSHTVVELIENGYDCVVADNLSNSTYDSVARLEVLTK
HHIPFYEVDLCDRKGLEKVFKEYKIDSVIHFAGLKAVGESTQIPLRYYHNNILGTVVLLE
LMQQYNVSKFVFSSSATVYGDATRFPNMIPIPEECPLGPTNPYGHTKYAIENILNDLYNS
DKKSWKFAILRYFNPIGAHPSGLIGEDPLGIPNNLLPYMAQVAVGRREKLYIFGDDYDSR
DGTPIRDYIHVVDLAKGHIAALQYLEAYNENEGLCREWNLGSGKGSTVFEVYHAFCKASG
IDLPYKVTGRRAGDVLNLTAKPDRAKRELKWQTELQVEDSCKDLWKWTTENPFGYQLRGV
EARFSAEDMRYDARFVTIGAGTRFQATFANLGASIVDLKVNGQSVVLGYENEEGYLNPDS
AYIGATIGRYANRISKGKFSLCNKDYQLTVNNGVNANHSSIGSFHRKRFLGPIIQNPSKD
VFTAEYMLIDNEKDTEFPGDLLVTIQYTVNVAQKSLEMVYKGKLTAGEATPINLTNHSYF
NLNKPYGDTIEGTEIMVRSKKSVDVDKNMIPTGNIVDREIATFNSTKPTVLGPKNPQFDC
CFVVDENAKPSQINTLNNELTLIVKAFHPDSNITLEVLSTEPTYQFYTGDFLSAGYEARQ
GFAIEPGRYIDAINQENWKDCVTLKNGETYGSKIVYRFS
Download sequence
Identical sequences A0A0L8VV82 A6ZKW5 B3LNC2 B5VDY8 C8Z413 P04397
YBR019C YBR019C SCRT_02946 YBR019C YBR019C YBR019C YBR019C 4932.YBR019C YBR019C YBR019C YBR019C YBR019C YBR019C tr|A6ZKW5|A6ZKW5_YEAS7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]