SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR019C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR019C
Domain Number 1 Region: 371-699
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.26e-92
Family Aldose 1-epimerase (mutarotase) 6.24e-12
Further Details:      
 
Domain Number 2 Region: 12-355
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.33e-91
Family Tyrosine-dependent oxidoreductases 3.31e-12
Further Details:      
 

Protein sequence

External link(s) Locus: YBR019C   Protein: S000000223
Sequence length 699
Comment GAL10 SGDID:S000000223, Chr II from 278352-276253, reverse complement, Verified ORF, "UDP-glucose-4-epimerase, catalyzes the interconversion of UDP-galactose and UDP-D-glucose in galactose metabolism; also catalyzes the conversion of alpha-D-glucose or alpha-D-galactose to their beta-anomers"
Sequence
MTAQLQSESTSKIVLVTGGAGYIGSHTVVELIENGYDCVVADNLSNSTYDSVARLEVLTK
HHIPFYEVDLCDRKGLEKVFKEYKIDSVIHFAGLKAVGESTQIPLRYYHNNILGTVVLLE
LMQQYNVSKFVFSSSATVYGDATRFPNMIPIPEECPLGPTNPYGHTKYAIENILNDLYNS
DKKSWKFAILRYFNPIGAHPSGLIGEDPLGIPNNLLPYMAQVAVGRREKLYIFGDDYDSR
DGTPIRDYIHVVDLAKGHIAALQYLEAYNENEGLCREWNLGSGKGSTVFEVYHAFCKASG
IDLPYKVTGRRAGDVLNLTAKPDRAKRELKWQTELQVEDSCKDLWKWTTENPFGYQLRGV
EARFSAEDMRYDARFVTIGAGTRFQATFANLGASIVDLKVNGQSVVLGYENEEGYLNPDS
AYIGATIGRYANRISKGKFSLCNKDYQLTVNNGVNANHSSIGSFHRKRFLGPIIQNPSKD
VFTAEYMLIDNEKDTEFPGDLLVTIQYTVNVAQKSLEMVYKGKLTAGEATPINLTNHSYF
NLNKPYGDTIEGTEIMVRSKKSVDVDKNMIPTGNIVDREIATFNSTKPTVLGPKNPQFDC
CFVVDENAKPSQINTLNNELTLIVKAFHPDSNITLEVLSTEPTYQFYTGDFLSAGYEARQ
GFAIEPGRYIDAINQENWKDCVTLKNGETYGSKIVYRFS
Download sequence
Identical sequences A6ZKW5 B3LNC2 B5VDY8 C8Z413 P04397 W7PXC5 W7RMK9
YBR019C YBR019C 4932.YBR019C YBR019C YBR019C YBR019C SCRT_02946 YBR019C YBR019C YBR019C tr|A6ZKW5|A6ZKW5_YEAS7 YBR019C YBR019C YBR019C

Jump to [ Top of page · Domain architecture · Domain assignment details ]