SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR021W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YBR021W   Protein: S000000225
Sequence length 633
Comment FUR4 SGDID:S000000225, Chr II from 281443-283344, Verified ORF, "Uracil permease, localized to the plasma membrane; expression is tightly regulated by uracil levels and environmental cues"
Sequence
MPDNLSLHLSGSSKRLNSRQLMESSNETFAPNNVDLEKEYKSSQSNITTEVYEASSFEEK
VSSEKPQYSSFWKKIYYEYVVVDKSILGVSILDSFMYNQDLKPVEKERRVWSWYNYCYFW
LAECFNINTWQIAATGLQLGLNWWQCWITIWIGYGFVGAFVVLASRVGSAYHLSFPISSR
ASFGIFFSLWPVINRVVMAIVWYSVQAYIAATPVSLMLKSIFGKDLQDKIPDHFGSPNAT
TYEFMCFFIFWAASLPFLLVPPHKIRHLFTVKAVLVPFASFGFLIWAIRRAHGRIALGSL
TDVQPHGSAFSWAFLRSLMGCMANFSTMVINAPDFSRFSKNPNSALWSQLVCIPFLFSIT
CLIGILVTAAGYEIYGINYWSPLDVLEKFLQTTYNKGTRAGVFLISFVFAVAQLGTNISA
NSLSCGTDMSAIFPKFINIKRGSLFCAAMALCICPWNLMATSSKFTMALSAYAIFLSSIA
GVVCSDYFVVRRGYIKLTHIYSHQKGSFYMYGNRFGINWRALAAYLCGVAPCLPGFIAEV
GAPAIKVSDGAMKLYYLSYWVGYGLSFSSYTALCYFFPVPGCPVNNIIKDKGWFQRWANV
DDFEEEWKDTIERDDLVDDNISVYEHEHEKTFI
Download sequence
Identical sequences A6ZKW7 B3LNC0 B5VDZ0 P05316
YBR021W 4932.YBR021W YBR021W YBR021W SCRT_02944 YBR021W YBR021W YBR021W tr|A6ZKW7|A6ZKW7_YEAS7 YBR021W 2340S YBR021W

Jump to [ Top of page · Domain architecture · Domain assignment details ]