SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR021W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YBR021W   Protein: S000000225
Sequence length 633
Comment FUR4 SGDID:S000000225, Chr II from 281443-283344, Verified ORF, "Uracil permease, localized to the plasma membrane; expression is tightly regulated by uracil levels and environmental cues"
Sequence
MPDNLSLHLSGSSKRLNSRQLMESSNETFAPNNVDLEKEYKSSQSNITTEVYEASSFEEK
VSSEKPQYSSFWKKIYYEYVVVDKSILGVSILDSFMYNQDLKPVEKERRVWSWYNYCYFW
LAECFNINTWQIAATGLQLGLNWWQCWITIWIGYGFVGAFVVLASRVGSAYHLSFPISSR
ASFGIFFSLWPVINRVVMAIVWYSVQAYIAATPVSLMLKSIFGKDLQDKIPDHFGSPNAT
TYEFMCFFIFWAASLPFLLVPPHKIRHLFTVKAVLVPFASFGFLIWAIRRAHGRIALGSL
TDVQPHGSAFSWAFLRSLMGCMANFSTMVINAPDFSRFSKNPNSALWSQLVCIPFLFSIT
CLIGILVTAAGYEIYGINYWSPLDVLEKFLQTTYNKGTRAGVFLISFVFAVAQLGTNISA
NSLSCGTDMSAIFPKFINIKRGSLFCAAMALCICPWNLMATSSKFTMALSAYAIFLSSIA
GVVCSDYFVVRRGYIKLTHIYSHQKGSFYMYGNRFGINWRALAAYLCGVAPCLPGFIAEV
GAPAIKVSDGAMKLYYLSYWVGYGLSFSSYTALCYFFPVPGCPVNNIIKDKGWFQRWANV
DDFEEEWKDTIERDDLVDDNISVYEHEHEKTFI
Download sequence
Identical sequences A6ZKW7 B3LNC0 B5VDZ0 P05316 W7PKX5 W7RE60
SCRT_02944 tr|A6ZKW7|A6ZKW7_YEAS7 YBR021W YBR021W 2340S YBR021W YBR021W YBR021W 4932.YBR021W YBR021W YBR021W YBR021W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]