SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR026C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR026C
Domain Number 1 Region: 146-335
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.37e-61
Family Alcohol dehydrogenase-like, C-terminal domain 6.04e-06
Further Details:      
 
Domain Number 2 Region: 37-184
Classification Level Classification E-value
Superfamily GroES-like 2.24e-21
Family Alcohol dehydrogenase-like, N-terminal domain 0.00016
Further Details:      
 

Protein sequence

External link(s) Locus: YBR026C   Protein: S000000230
Sequence length 380
Comment ETR1 SGDID:S000000230, Chr II from 294019-292877, reverse complement, Verified ORF, "2-enoyl thioester reductase, member of the medium chain dehydrogenase/reductase family; localized to in mitochondria, where it has a probable role in fatty acid synthesis"
Sequence
MLPTFKRYMSSSAHQIPKHFKSLIYSTHEVEDCTKVLSVKNYTPKQDLSQSIVLKTLAFP
INPSDINQLQGVYPSRPEKTYDYSTDEPAAIAGNEGVFEVVSLPSGSSKGDLKLGDRVIP
LQANQGTWSNYRVFSSSSDLIKVNDLDLFSAATVSVNGCTGFQLVSDYIDWNSNGNEWII
QNAGTSSVSKIVTQVAKAKGIKTLSVIRDRDNFDEVAKVLEDKYGATKVISESQNNDKTF
AKEVLSKILGENARVRLALNSVGGKSSASIARKLENNALMLTYGGMSKQPVTLPTSLHIF
KGLTSKGYWVTEKNKKNPQSKIDTISDFIKMYNYGHIISPRDEIETLTWNTNTTTDEQLL
ELVKKGITGKGKKKMVVLEW
Download sequence
Identical sequences A6ZKX2 B3LNB7 C8Z420 E7K9Q9 P38071
YBR026C 4932.YBR026C YBR026C YBR026C SCRT_02939 YBR026C tr|A6ZKX2|A6ZKX2_YEAS7 YBR026C YBR026c___KOG0025 YBR026C YBR026C YBR026C

Jump to [ Top of page · Domain architecture · Domain assignment details ]