SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YBR026C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR026C
Domain Number 1 Region: 146-335
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.37e-61
Family Alcohol dehydrogenase-like, C-terminal domain 0.00000604
Further Details:      
 
Domain Number 2 Region: 37-184
Classification Level Classification E-value
Superfamily GroES-like 2.24e-21
Family Alcohol dehydrogenase-like, N-terminal domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
integral to plasma membrane 1.469 17.18
cilium 1.61 15.49
cilium part 1.917 15.49
microbody 1.955 12.44
synapse part 1.512 9.56
axon 1.502 9.56
cation channel complex 2.038 7.94
Golgi membrane 1.605 7.27
intrinsic to organelle membrane 2.082 7.27
neuron projection terminus 2.106 6.64

Protein sequence

External link(s) Locus: YBR026C   Protein: S000000230
Sequence length 380
Comment ETR1 SGDID:S000000230, Chr II from 294019-292877, reverse complement, Verified ORF, "2-enoyl thioester reductase, member of the medium chain dehydrogenase/reductase family; localized to in mitochondria, where it has a probable role in fatty acid synthesis"
Sequence
MLPTFKRYMSSSAHQIPKHFKSLIYSTHEVEDCTKVLSVKNYTPKQDLSQSIVLKTLAFP
INPSDINQLQGVYPSRPEKTYDYSTDEPAAIAGNEGVFEVVSLPSGSSKGDLKLGDRVIP
LQANQGTWSNYRVFSSSSDLIKVNDLDLFSAATVSVNGCTGFQLVSDYIDWNSNGNEWII
QNAGTSSVSKIVTQVAKAKGIKTLSVIRDRDNFDEVAKVLEDKYGATKVISESQNNDKTF
AKEVLSKILGENARVRLALNSVGGKSSASIARKLENNALMLTYGGMSKQPVTLPTSLHIF
KGLTSKGYWVTEKNKKNPQSKIDTISDFIKMYNYGHIISPRDEIETLTWNTNTTTDEQLL
ELVKKGITGKGKKKMVVLEW
Download sequence
Identical sequences A6ZKX2 B3LNB7 C8Z420 E7K9Q9 P38071 W7PKY0 W7RE65
YBR026C YBR026c___KOG0025 SCRT_02939 YBR026C tr|A6ZKX2|A6ZKX2_YEAS7 4932.YBR026C YBR026C YBR026C YBR026C YBR026C YBR026C YBR026C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]