SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR056W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YBR056W-A   Protein: S000028736
Sequence length 66
Comment YBR056W-A SGDID:S000028736, Chr II from 351253-351453, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps the dubious ORF YBR056C-B"
Sequence
MRHQYYQPQPMYYQPQPQPIYIQQGPPPPRNDCCCCCNCGDCCSAIANVLCCLCLIDLCC
SCAGGM
Download sequence
Identical sequences A6ZL00 D3UEF2 I2HB52 W7PXF6
YBR056W-A YBR056W-A YBR056W-A YBR056W-A YBR056W-A YBR056W-A YBR056W-A YBR056W-A 4932.YBR056W-A YBR056W-A YBR056W-A YBR056W-A YBR056W-A YBR056W-A YBR056W-A YBR056W-A YBR056W-A YBR056W-A tr|A6ZL00|A6ZL00_YEAS7 YBR056W-A YBR056W-A YBR056W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]