SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR056W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YBR056W-A   Protein: S000028736
Sequence length 66
Comment YBR056W-A SGDID:S000028736, Chr II from 351253-351453, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps the dubious ORF YBR056C-B"
Sequence
MRHQYYQPQPMYYQPQPQPIYIQQGPPPPRNDCCCCCNCGDCCSAIANVLCCLCLIDLCC
SCAGGM
Download sequence
Identical sequences A6ZL00 D3UEF2 I2HB52
YBR056W-A YBR056W-A YBR056W-A YBR056W-A YBR056W-A YBR056W-A YBR056W-A YBR056W-A YBR056W-A YBR056W-A 4932.YBR056W-A YBR056W-A YBR056W-A YBR056W-A tr|A6ZL00|A6ZL00_YEAS7 YBR056W-A YBR056W-A YBR056W-A YBR056W-A YBR056W-A YBR056W-A YBR056W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]