SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR070C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YBR070C   Protein: S000000274
Sequence length 237
Comment ALG14 SGDID:S000000274, Chr II from 379931-379218, reverse complement, Verified ORF, "Component of UDP-GlcNAc transferase required for the second step of dolichyl-linked oligosaccharide synthesis; anchors the catalytic subunit Alg13p to the ER membrane; similar to bacterial and human glycosyltransferases"
Sequence
MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKSSKKPLKIFVF
LGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRFAHFIKKFGHCKVKYYEFMKA
REVKATLLQSVKTIIGTLVQSFVHVVRIRFAMCGSPHLFLLNGPGTCCIISFWLKIMELL
LPLLGSSHIVYVESLARINTPSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGILV
Download sequence
Identical sequences N1P9E2 P38242
YBR070C YBR070C YBR070C YBR070C YBR070C 4932.YBR070C YBR070C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]