SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR070C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YBR070C   Protein: S000000274
Sequence length 237
Comment ALG14 SGDID:S000000274, Chr II from 379931-379218, reverse complement, Verified ORF, "Component of UDP-GlcNAc transferase required for the second step of dolichyl-linked oligosaccharide synthesis; anchors the catalytic subunit Alg13p to the ER membrane; similar to bacterial and human glycosyltransferases"
Sequence
MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKSSKKPLKIFVF
LGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRFAHFIKKFGHCKVKYYEFMKA
REVKATLLQSVKTIIGTLVQSFVHVVRIRFAMCGSPHLFLLNGPGTCCIISFWLKIMELL
LPLLGSSHIVYVESLARINTPSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGILV
Download sequence
Identical sequences P38242
YBR070C YBR070C YBR070C 4932.YBR070C YBR070C YBR070C YBR070C

Jump to [ Top of page · Domain architecture · Domain assignment details ]