SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR072W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR072W
Domain Number 1 Region: 66-198
Classification Level Classification E-value
Superfamily HSP20-like chaperones 2.23e-27
Family HSP20 0.003
Further Details:      
 

Protein sequence

External link(s) Locus: YBR072W   Protein: S000000276
Sequence length 214
Comment HSP26 SGDID:S000000276, Chr II from 382027-382671, Verified ORF, "Small heat shock protein (sHSP) with chaperone activity; forms hollow, sphere-shaped oligomers that suppress unfolded proteins aggregation; oligomer activation requires a heat-induced conformational change; not expressed in unstressed cells"
Sequence
MSFNSPFFDFFDNINNEVDAFNRLLGEGGLRGYAPRRQLANTPAKDSTGKEVARPNNYAG
ALYDPRDETLDDWFDNDLSLFPSGFGFPRSVAVPVDILDHDNNYELKVVVPGVKSKKDID
IEYHQNKNQILVSGEIPSTLNEESKDKVKVKESSSGKFKRVITLPDYPGVDADNIKADYA
NGVLTLTVPKLKPQKDGKNHVKKIEVSSQESWGN
Download sequence
Identical sequences G2W977 P15992
YBR072W YBR072W 4932.YBR072W YBR072W YBR072W YBR072W

Jump to [ Top of page · Domain architecture · Domain assignment details ]