SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR072W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR072W
Domain Number 1 Region: 66-198
Classification Level Classification E-value
Superfamily HSP20-like chaperones 2.23e-27
Family HSP20 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
chromosomal part 1.477 4.46
Biological Process IC (bits) H-Score
response to heat 1.973 48.93
protein phosphorylation 1.433 45.86
response to temperature stimulus 1.669 34.93
cellular macromolecular complex assembly 1.469 34.03
response to hydrogen peroxide 2.247 28.82
stem cell division 2.111 27.47
neural precursor cell proliferation 2.144 27.47
stem cell proliferation 2.06 27.47
cell proliferation 1.393 27.47
cell division 1.6 27.47

Protein sequence

External link(s) Locus: YBR072W   Protein: S000000276
Sequence length 214
Comment HSP26 SGDID:S000000276, Chr II from 382027-382671, Verified ORF, "Small heat shock protein (sHSP) with chaperone activity; forms hollow, sphere-shaped oligomers that suppress unfolded proteins aggregation; oligomer activation requires a heat-induced conformational change; not expressed in unstressed cells"
Sequence
MSFNSPFFDFFDNINNEVDAFNRLLGEGGLRGYAPRRQLANTPAKDSTGKEVARPNNYAG
ALYDPRDETLDDWFDNDLSLFPSGFGFPRSVAVPVDILDHDNNYELKVVVPGVKSKKDID
IEYHQNKNQILVSGEIPSTLNEESKDKVKVKESSSGKFKRVITLPDYPGVDADNIKADYA
NGVLTLTVPKLKPQKDGKNHVKKIEVSSQESWGN
Download sequence
Identical sequences G2W977 N1P6J1 P15992
YBR072W YBR072W 4932.YBR072W YBR072W YBR072W YBR072W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]