SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR076C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YBR076C-A
Domain Number - Region: 7-31
Classification Level Classification E-value
Superfamily 14-3-3 protein 0.0392
Family 14-3-3 protein 0.014
Further Details:      
 

Protein sequence

External link(s) Locus: YBR076C-A   Protein: S000028533
Sequence length 88
Comment YBR076C-A SGDID:S000028533, Chr II from 391611-391345, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein; partially overlaps verified gene ECM8; identified by fungal homology and RT-PCR"
Sequence
MHVHKGLIFLSFFSPIYLSLLLNGSIFFFYYAQRALHDSFFFPNELLRCQICLCSLFWMV
TVINLKRFFARMVNISIYQPSRNRLVRY
Download sequence
Identical sequences P0C5L2
YBR076C-A YBR076C-A 4932.YBR076C-A YBR076C-A YBR076C-A YBR076C-A YBR076C-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]