SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR076C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YBR076C-A
Domain Number - Region: 7-31
Classification Level Classification E-value
Superfamily 14-3-3 protein 0.0392
Family 14-3-3 protein 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YBR076C-A   Protein: S000028533
Sequence length 88
Comment YBR076C-A SGDID:S000028533, Chr II from 391611-391345, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein; partially overlaps verified gene ECM8; identified by fungal homology and RT-PCR"
Sequence
MHVHKGLIFLSFFSPIYLSLLLNGSIFFFYYAQRALHDSFFFPNELLRCQICLCSLFWMV
TVINLKRFFARMVNISIYQPSRNRLVRY
Download sequence
Identical sequences P0C5L2
YBR076C-A YBR076C-A YBR076C-A YBR076C-A YBR076C-A YBR076C-A 4932.YBR076C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]