SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YBR080C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR080C
Domain Number 1 Region: 242-520
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.76e-50
Family Extended AAA-ATPase domain 0.0000147
Further Details:      
 
Domain Number 2 Region: 109-221
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 8.83e-35
Family Cdc48 domain 2-like 0.00000134
Further Details:      
 
Domain Number 3 Region: 27-106
Classification Level Classification E-value
Superfamily ADC-like 4.72e-29
Family Cdc48 N-terminal domain-like 0.00000385
Further Details:      
 
Domain Number 4 Region: 519-735
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.01e-21
Family Extended AAA-ATPase domain 0.0000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
microtubule associated complex 1.998 25.22
chromosomal part 1.478 20.33
nucleoplasm part 1.419 15.58
endosome 1.322 14.28
cilium 1.61 13.75
extrinsic to plasma membrane 1.991 12.72
internal side of plasma membrane 2.098 12.69
extracellular organelle 1.592 12.36
transcription factor complex 1.881 9.42
DNA-directed RNA polymerase complex 2.004 9.42

Protein sequence

External link(s) Locus: YBR080C   Protein: S000000284
Sequence length 758
Comment SEC18 SGDID:S000000284, Chr II from 400884-398608, reverse complement, Verified ORF, "ATPase required for the release of Sec17p during the 'priming' step in homotypic vacuole fusion and for ER to Golgi transport; homolog of the mammalian NSF"
Sequence
MFKIPGFGKAAANHTPPDMTNMDTRTRHLKVSNCPNNSYALANVAAVSPNDFPNNIYIII
DNLFVFTTRHSNDIPPGTIGFNGNQRTWGGWSLNQDVQAKAFDLFKYSGKQSYLGSIDID
ISFRARGKAVSTVFDQDELAKQFVRCYESQIFSPTQYLIMEFQGHFFDLKIRNVQAIDLG
DIEPTSAVATGIETKGILTKQTQINFFKGRDGLVNLKSSNSLRPRSNAVIRPDFKFEDLG
VGGLDKEFTKIFRRAFASRIFPPSVIEKLGISHVKGLLLYGPPGTGKTLIARKIGTMLNA
KEPKIVNGPEILSKYVGSSEENIRNLFKDAEAEYRAKGEESSLHIIIFDELDSVFKQRGS
RGDGTGVGDNVVNQLLAKMDGVDQLNNILVIGMTNRKDLIDSALLRPGRFEVQVEIHLPD
EKGRLQIFDIQTKKMRENNMMSDDVNLAELAALTKNFSGAEIEGLVKSASSFAINKTVNI
GKGATKLNTKDIAKLKVTREDFLNALNDVTPAFGISEEDLKTCVEGGMMLYSERVNSILK
NGARYVRQVRESDKSRLVSLLIHGPAGSGKTALAAEIALKSGFPFIRLISPNELSGMSES
AKIAYIDNTFRDAYKSPLNILVIDSLETLVDWVPIGPRFSNNILQMLKVALKRKPPQDRR
LLIMTTTSAYSVLQQMDILSCFDNEIAVPNMTNLDELNNVMIESNFLDDAGRVKVINELS
RSCPNFNVGIKKTLTNIETARHDEDPVNELVELMTQSA
Download sequence
Identical sequences N1P9E8 P18759
YBR080C YBR080C YBR080C YBR080c___KOG0741 YBR080C YBR080C 4932.YBR080C YBR080C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]