SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YBR080C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR080C
Domain Number 1 Region: 242-520
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.76e-50
Family Extended AAA-ATPase domain 0.0000147
Further Details:      
 
Domain Number 2 Region: 109-221
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 8.83e-35
Family Cdc48 domain 2-like 0.00000134
Further Details:      
 
Domain Number 3 Region: 27-106
Classification Level Classification E-value
Superfamily ADC-like 4.72e-29
Family Cdc48 N-terminal domain-like 0.00000385
Further Details:      
 
Domain Number 4 Region: 519-735
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.01e-21
Family Extended AAA-ATPase domain 0.0000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
actin cytoskeleton 1.374 29.03
oxidoreductase complex 1.828 27.05
cilium 1.675 22.42
transporter complex 1.698 22.26
ATPase complex 2.002 22.1
ciliary part 1.819 21.32
chromosomal part 1.512 20.08
midbody 2.182 17.6
side of membrane 1.633 16
nucleoplasm part 1.369 15.74

Protein sequence

External link(s) Locus: YBR080C   Protein: S000000284
Sequence length 758
Comment SEC18 SGDID:S000000284, Chr II from 400884-398608, reverse complement, Verified ORF, "ATPase required for the release of Sec17p during the 'priming' step in homotypic vacuole fusion and for ER to Golgi transport; homolog of the mammalian NSF"
Sequence
MFKIPGFGKAAANHTPPDMTNMDTRTRHLKVSNCPNNSYALANVAAVSPNDFPNNIYIII
DNLFVFTTRHSNDIPPGTIGFNGNQRTWGGWSLNQDVQAKAFDLFKYSGKQSYLGSIDID
ISFRARGKAVSTVFDQDELAKQFVRCYESQIFSPTQYLIMEFQGHFFDLKIRNVQAIDLG
DIEPTSAVATGIETKGILTKQTQINFFKGRDGLVNLKSSNSLRPRSNAVIRPDFKFEDLG
VGGLDKEFTKIFRRAFASRIFPPSVIEKLGISHVKGLLLYGPPGTGKTLIARKIGTMLNA
KEPKIVNGPEILSKYVGSSEENIRNLFKDAEAEYRAKGEESSLHIIIFDELDSVFKQRGS
RGDGTGVGDNVVNQLLAKMDGVDQLNNILVIGMTNRKDLIDSALLRPGRFEVQVEIHLPD
EKGRLQIFDIQTKKMRENNMMSDDVNLAELAALTKNFSGAEIEGLVKSASSFAINKTVNI
GKGATKLNTKDIAKLKVTREDFLNALNDVTPAFGISEEDLKTCVEGGMMLYSERVNSILK
NGARYVRQVRESDKSRLVSLLIHGPAGSGKTALAAEIALKSGFPFIRLISPNELSGMSES
AKIAYIDNTFRDAYKSPLNILVIDSLETLVDWVPIGPRFSNNILQMLKVALKRKPPQDRR
LLIMTTTSAYSVLQQMDILSCFDNEIAVPNMTNLDELNNVMIESNFLDDAGRVKVINELS
RSCPNFNVGIKKTLTNIETARHDEDPVNELVELMTQSA
Download sequence
Identical sequences N1P9E8 P18759
YBR080C 4932.YBR080C YBR080C YBR080C YBR080C YBR080C YBR080C YBR080c___KOG0741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]