SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR080C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR080C
Domain Number 1 Region: 242-520
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.76e-50
Family Extended AAA-ATPase domain 1.47e-05
Further Details:      
 
Domain Number 2 Region: 109-221
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 8.83e-35
Family Cdc48 domain 2-like 1.34e-06
Further Details:      
 
Domain Number 3 Region: 27-106
Classification Level Classification E-value
Superfamily ADC-like 4.72e-29
Family Cdc48 N-terminal domain-like 3.85e-06
Further Details:      
 
Domain Number 4 Region: 519-735
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.01e-21
Family Extended AAA-ATPase domain 2.34e-05
Further Details:      
 

Most Informative Gene Ontologies

Molecular Function IC (bits) H-Score
purine ribonucleoside binding 1.42 72.62
guanyl nucleotide binding 2.074 71.86
purine ribonucleoside triphosphate binding 1.453 69.94
ATPase activity, coupled 1.557 68.47
purine NTP-dependent helicase activity 2.034 68.47
phosphotransferase activity, phosphate group as acceptor 2.214 36.72
P-P-bond-hydrolysis-driven transmembrane transporter activity 1.989 35.05
oxidoreductase activity, acting on the aldehyde or oxo group of donors 1.879 27.73
translation factor activity, nucleic acid binding 1.873 18.7
nucleotidyltransferase activity 1.651 12.98
Cellular Component IC (bits) H-Score
microtubule associated complex 1.999 25.68
chromosomal part 1.477 20.4
nucleoplasm part 1.418 15.58
endosome 1.325 13.96
cilium 1.617 13.18
extrinsic to plasma membrane 1.993 12.72
internal side of plasma membrane 2.099 12.47
extracellular organelle 1.593 12.35
ribonucleoprotein complex 1.418 9.43
transcription factor complex 1.882 9.42
Biological Process IC (bits) H-Score
purine nucleoside triphosphate metabolic process 1.5 117.65
glycosyl compound catabolic process 1.531 110.77
purine-containing compound catabolic process 1.507 109.32
purine ribonucleoside metabolic process 1.419 107.67
organophosphate catabolic process 1.496 104.78
purine ribonucleotide metabolic process 1.37 103.88
carbohydrate derivative catabolic process 1.425 98.11
nucleobase-containing compound catabolic process 1.341 89.06
purine ribonucleoside monophosphate metabolic process 1.46 88.25
DNA conformation change 1.678 48.54

Protein sequence

External link(s) Locus: YBR080C   Protein: S000000284
Sequence length 758
Comment SEC18 SGDID:S000000284, Chr II from 400884-398608, reverse complement, Verified ORF, "ATPase required for the release of Sec17p during the 'priming' step in homotypic vacuole fusion and for ER to Golgi transport; homolog of the mammalian NSF"
Sequence
MFKIPGFGKAAANHTPPDMTNMDTRTRHLKVSNCPNNSYALANVAAVSPNDFPNNIYIII
DNLFVFTTRHSNDIPPGTIGFNGNQRTWGGWSLNQDVQAKAFDLFKYSGKQSYLGSIDID
ISFRARGKAVSTVFDQDELAKQFVRCYESQIFSPTQYLIMEFQGHFFDLKIRNVQAIDLG
DIEPTSAVATGIETKGILTKQTQINFFKGRDGLVNLKSSNSLRPRSNAVIRPDFKFEDLG
VGGLDKEFTKIFRRAFASRIFPPSVIEKLGISHVKGLLLYGPPGTGKTLIARKIGTMLNA
KEPKIVNGPEILSKYVGSSEENIRNLFKDAEAEYRAKGEESSLHIIIFDELDSVFKQRGS
RGDGTGVGDNVVNQLLAKMDGVDQLNNILVIGMTNRKDLIDSALLRPGRFEVQVEIHLPD
EKGRLQIFDIQTKKMRENNMMSDDVNLAELAALTKNFSGAEIEGLVKSASSFAINKTVNI
GKGATKLNTKDIAKLKVTREDFLNALNDVTPAFGISEEDLKTCVEGGMMLYSERVNSILK
NGARYVRQVRESDKSRLVSLLIHGPAGSGKTALAAEIALKSGFPFIRLISPNELSGMSES
AKIAYIDNTFRDAYKSPLNILVIDSLETLVDWVPIGPRFSNNILQMLKVALKRKPPQDRR
LLIMTTTSAYSVLQQMDILSCFDNEIAVPNMTNLDELNNVMIESNFLDDAGRVKVINELS
RSCPNFNVGIKKTLTNIETARHDEDPVNELVELMTQSA
Download sequence
Identical sequences N1P9E8 P18759
YBR080C 4932.YBR080C YBR080C YBR080C YBR080C YBR080C YBR080c___KOG0741 YBR080C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]