SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR080C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR080C
Domain Number 1 Region: 242-520
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.76e-50
Family Extended AAA-ATPase domain 1.47e-05
Further Details:      
 
Domain Number 2 Region: 109-221
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 8.83e-35
Family Cdc48 domain 2-like 1.34e-06
Further Details:      
 
Domain Number 3 Region: 27-106
Classification Level Classification E-value
Superfamily ADC-like 4.72e-29
Family Cdc48 N-terminal domain-like 3.85e-06
Further Details:      
 
Domain Number 4 Region: 519-735
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.01e-21
Family Extended AAA-ATPase domain 2.34e-05
Further Details:      
 

Protein sequence

External link(s) Locus: YBR080C   Protein: S000000284
Sequence length 758
Comment SEC18 SGDID:S000000284, Chr II from 400884-398608, reverse complement, Verified ORF, "ATPase required for the release of Sec17p during the 'priming' step in homotypic vacuole fusion and for ER to Golgi transport; homolog of the mammalian NSF"
Sequence
MFKIPGFGKAAANHTPPDMTNMDTRTRHLKVSNCPNNSYALANVAAVSPNDFPNNIYIII
DNLFVFTTRHSNDIPPGTIGFNGNQRTWGGWSLNQDVQAKAFDLFKYSGKQSYLGSIDID
ISFRARGKAVSTVFDQDELAKQFVRCYESQIFSPTQYLIMEFQGHFFDLKIRNVQAIDLG
DIEPTSAVATGIETKGILTKQTQINFFKGRDGLVNLKSSNSLRPRSNAVIRPDFKFEDLG
VGGLDKEFTKIFRRAFASRIFPPSVIEKLGISHVKGLLLYGPPGTGKTLIARKIGTMLNA
KEPKIVNGPEILSKYVGSSEENIRNLFKDAEAEYRAKGEESSLHIIIFDELDSVFKQRGS
RGDGTGVGDNVVNQLLAKMDGVDQLNNILVIGMTNRKDLIDSALLRPGRFEVQVEIHLPD
EKGRLQIFDIQTKKMRENNMMSDDVNLAELAALTKNFSGAEIEGLVKSASSFAINKTVNI
GKGATKLNTKDIAKLKVTREDFLNALNDVTPAFGISEEDLKTCVEGGMMLYSERVNSILK
NGARYVRQVRESDKSRLVSLLIHGPAGSGKTALAAEIALKSGFPFIRLISPNELSGMSES
AKIAYIDNTFRDAYKSPLNILVIDSLETLVDWVPIGPRFSNNILQMLKVALKRKPPQDRR
LLIMTTTSAYSVLQQMDILSCFDNEIAVPNMTNLDELNNVMIESNFLDDAGRVKVINELS
RSCPNFNVGIKKTLTNIETARHDEDPVNELVELMTQSA
Download sequence
Identical sequences N1P9E8 P18759
YBR080C 4932.YBR080C YBR080C YBR080C YBR080C YBR080C YBR080c___KOG0741 YBR080C

Jump to [ Top of page · Domain architecture · Domain assignment details ]