SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YBR084C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR084C-A
Domain Number 1 Region: 3-143
Classification Level Classification E-value
Superfamily Ribosomal protein L19 (L19e) 7.06e-57
Family Ribosomal protein L19 (L19e) 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
structural constituent of ribosome 1.959 30.21
Biological Process IC (bits) H-Score
ribonucleoprotein complex assembly 1.922 15.81
ribosome biogenesis 1.853 12.62
ribonucleoprotein complex biogenesis 1.7 10.8
translation 1.514 7.57
Cellular Component IC (bits) H-Score
ribosomal subunit 1.983 17.92
intracellular ribonucleoprotein complex 1.368 10.91
cytosol 1.295 3.41
cytosolic ribosome 2.235 3.1

Protein sequence

External link(s) Locus: YBR084C-A   Protein: S000002156
Sequence length 189
Comment RPL19A SGDID:S000002156, Chr II from 415255-415254,414747-414180, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl19Bp and has similarity to rat L19 ribosomal protein; rpl19a and rpl19b single null mutations result in slow growth, while the double null mutation is lethal"
Sequence
MANLRTQKRLAASVVGVGKRKVWLDPNETSEIAQANSRNAIRKLVKNGTIVKKAVTVHSK
SRTRAHAQSKREGRHSGYGKRKGTREARLPSQVVWIRRLRVLRRLLAKYRDAGKIDKHLY
HVLYKESKGNAFKHKRALVEHIIQAKADAQREKALNEEAEARRLKNRAARDRRAQRVAEK
RDALLKEDA
Download sequence
Identical sequences A6ZKS1 C8Z3W9 G2W991 P0CX82 P0CX83
YBL027W YBR084C-A YBR084C-A YBL027W YBL027W YBR084C-A YBL027W YBR084C-A YBL027W YBR084C-A YBL027W YBR084C-A YBR084C-A 4932.YBL027W 4932.YBR084C-A YBL027W YBR084C-A 2ww9.J 2wwa.J 2wwb.J 3j6x.59 3j6y.59 3j77.69 3j78.69 3jct.R 4v6i.BT 4v7f.R 4v7r.BS 4v7r.DS 4v88.BR 4v88.DR 4v8t.R 4v91.R 5apn.R 5apo.R 5fl8.R 5gak.T 5h4p.R 5jcs.R 5juo.W 5jup.W 5jus.W 5jut.W 5juu.W 5mc6.BF 5t62.e 5t6r.e YBL027W YBR084C-A YBL027W YBR084C-A tr|A6ZKS1|A6ZKS1_YEAS7 YBL027W YBR084C-A YBL027W YBR084C-A YBL027W YBR084C-A YBL027W YBR084C-A YBL027W YBR084C-A YBL027W YBR084C-A YBL027W YBR084C-A YBL027W YBR084C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]