SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR084C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR084C-A
Domain Number 1 Region: 3-143
Classification Level Classification E-value
Superfamily Ribosomal protein L19 (L19e) 7.06e-57
Family Ribosomal protein L19 (L19e) 0.00014
Further Details:      
 

Protein sequence

External link(s) Locus: YBR084C-A   Protein: S000002156
Sequence length 189
Comment RPL19A SGDID:S000002156, Chr II from 415255-415254,414747-414180, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl19Bp and has similarity to rat L19 ribosomal protein; rpl19a and rpl19b single null mutations result in slow growth, while the double null mutation is lethal"
Sequence
MANLRTQKRLAASVVGVGKRKVWLDPNETSEIAQANSRNAIRKLVKNGTIVKKAVTVHSK
SRTRAHAQSKREGRHSGYGKRKGTREARLPSQVVWIRRLRVLRRLLAKYRDAGKIDKHLY
HVLYKESKGNAFKHKRALVEHIIQAKADAQREKALNEEAEARRLKNRAARDRRAQRVAEK
RDALLKEDA
Download sequence
Identical sequences A6ZKS1 C8Z3W9 G2W991 P0CX82 P0CX83
YBL027W YBR084C-A YBL027W YBR084C-A YBL027W YBR084C-A YBL027W YBR084C-A YBL027W YBR084C-A YBR084C-A YBL027W YBR084C-A YBL027W YBR084C-A YBL027W YBR084C-A YBL027W YBR084C-A 4932.YBL027W 4932.YBR084C-A YBL027W YBR084C-A YBL027W YBR084C-A tr|A6ZKS1|A6ZKS1_YEAS7 YBL027W YBR084C-A 2ww9.J 2wwa.J 2wwb.J 3izc.T 3izs.T 3o58.S 3o5h.S 3u5e.R 3u5i.R 4b6a.R YBL027W YBR084C-A YBL027W YBR084C-A YBL027W YBR084C-A YBL027W YBR084C-A YBL027W YBR084C-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]