SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR085W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR085W
Domain Number 1 Region: 9-297
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.44e-76
Family Mitochondrial carrier 7.8e-08
Further Details:      
 

Protein sequence

External link(s) Locus: YBR085W   Protein: S000000289
Sequence length 307
Comment AAC3 SGDID:S000000289, Chr II from 415977-416900, Verified ORF, "Mitochondrial inner membrane ADP/ATP translocator, exchanges cytosolic ADP for mitochondrially synthesized ATP; expressed under anaerobic conditions; similar to Pet9p and Aac1p; has roles in maintenance of viability and in respiration"
Sequence
MSSDAKQQETNFAINFLMGGVSAAIAKTAASPIERVKILIQNQDEMIKQGTLDKKYSGIV
DCFKRTAKQEGLISFWRGNTANVIRYFPTQALNFAFKDKIKLMFGFKKEEGYGKWFAGNL
ASGGAAGALSLLFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAGLYR
GFMPSVVGIVVYRGLYFGMFDSLKPLVLTGSLDGSFLASFLLGWVVTTGASTCSYPLDTV
RRRMMMTSGQAVKYNGAIDCLKKIVASEGVGSLFKGCGANILRSVAGAGVISMYDQLQMI
LFGKKFK
Download sequence
Identical sequences A6ZL32 E7NEV5 G2W992 N1P838 P18238
YBR085W YBR085W 4932.YBR085W YBR085W YBR085W YBR085W tr|A6ZL32|A6ZL32_YEAS7 YBR085W YBR085W YBR085W 4284S YBR085W YBR085W YBR085W

Jump to [ Top of page · Domain architecture · Domain assignment details ]