SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR085W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR085W
Domain Number 1 Region: 9-297
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.44e-76
Family Mitochondrial carrier 7.8e-08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
organelle inner membrane 1.673 62.04
mitochondrial envelope 1.571 58.85
microtubule cytoskeleton 1.334 20.08
plastid 1.598 10.19
chloroplast part 1.897 10.19
mitochondrial inner membrane 1.752 5.48
microbody 1.956 4.87
intrinsic to organelle membrane 2.091 4.87
outer membrane 2.24 4.86
mitochondrial membrane part 1.917 4.04

Protein sequence

External link(s) Locus: YBR085W   Protein: S000000289
Sequence length 307
Comment AAC3 SGDID:S000000289, Chr II from 415977-416900, Verified ORF, "Mitochondrial inner membrane ADP/ATP translocator, exchanges cytosolic ADP for mitochondrially synthesized ATP; expressed under anaerobic conditions; similar to Pet9p and Aac1p; has roles in maintenance of viability and in respiration"
Sequence
MSSDAKQQETNFAINFLMGGVSAAIAKTAASPIERVKILIQNQDEMIKQGTLDKKYSGIV
DCFKRTAKQEGLISFWRGNTANVIRYFPTQALNFAFKDKIKLMFGFKKEEGYGKWFAGNL
ASGGAAGALSLLFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAGLYR
GFMPSVVGIVVYRGLYFGMFDSLKPLVLTGSLDGSFLASFLLGWVVTTGASTCSYPLDTV
RRRMMMTSGQAVKYNGAIDCLKKIVASEGVGSLFKGCGANILRSVAGAGVISMYDQLQMI
LFGKKFK
Download sequence
Identical sequences A6ZL32 E7NEV5 G2W992 N1P838 P18238
YBR085W YBR085W 4932.YBR085W YBR085W YBR085W YBR085W tr|A6ZL32|A6ZL32_YEAS7 YBR085W YBR085W YBR085W 4284S YBR085W YBR085W YBR085W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]