SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR089C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR089C-A
Domain Number 1 Region: 12-96
Classification Level Classification E-value
Superfamily HMG-box 7.39e-29
Family HMG-box 0.00000568
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)


Protein sequence

External link(s) Locus: YBR089C-A   Protein: S000002157
Sequence length 99
Comment NHP6B SGDID:S000002157, Chr II from 426483-426184, reverse complement, Verified ORF, "High-mobility group non-histone chromatin protein, functionally redundant with Nhp6Ap; homologous to mammalian high mobility group proteins 1 and 2; acts to recruit transcription factor Rcs1p to certain promoters"
Sequence
MAATKEAKQPKEPKKRTTRRKKDPNAPKRRLSAYMFFANENRDIVRSENPDVTFGQVGRI
LGERWKALTAEEKQPYESKAQADKKRYESEKELYNATRA
Download sequence
Identical sequences 4932.YBR089C-A YBR089C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]