SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR089C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR089C-A
Domain Number 1 Region: 12-96
Classification Level Classification E-value
Superfamily HMG-box 7.39e-29
Family HMG-box 5.68e-06
Further Details:      
 

Protein sequence

External link(s) Locus: YBR089C-A   Protein: S000002157
Sequence length 99
Comment NHP6B SGDID:S000002157, Chr II from 426483-426184, reverse complement, Verified ORF, "High-mobility group non-histone chromatin protein, functionally redundant with Nhp6Ap; homologous to mammalian high mobility group proteins 1 and 2; acts to recruit transcription factor Rcs1p to certain promoters"
Sequence
MAATKEAKQPKEPKKRTTRRKKDPNAPKRRLSAYMFFANENRDIVRSENPDVTFGQVGRI
LGERWKALTAEEKQPYESKAQADKKRYESEKELYNATRA
Download sequence
Identical sequences YBR089C-A 4932.YBR089C-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]