SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR091C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR091C
Domain Number 1 Region: 25-95
Classification Level Classification E-value
Superfamily Tim10-like 1.96e-17
Family Tim10/DDP 0.0013
Further Details:      
 

Protein sequence

External link(s) Locus: YBR091C   Protein: S000000295
Sequence length 109
Comment MRS5 SGDID:S000000295, Chr II from 427478-427149, reverse complement, Verified ORF, "Essential protein of the inner mitochondrial membrane, peripherally localized; component of the TIM22 complex, which is a twin-pore translocase that mediates insertion of numerous multispanning inner membrane proteins"
Sequence
MSFFLNSLRGNQEVSQEKLDVAGVQFDAMCSTFNNILSTCLEKCIPHEGFGEPDLTKGEQ
CCIDRCVAKMHYSNRLIGGFVQTRGFGPENQLRHYSRFVAKEIADDSKK
Download sequence
Identical sequences A6ZL38 B3LN60 C7GJR9 D3UEI6 G2W999 P32830
YBR091C YBR091C YBR091C YBR091C YBR091C YBR091C YBR091C YBR091C YBR091C YBR091C 354913 YT38 YBR091C YBR091C YBR091C YBR091C 4932.YBR091C YBR091C YBR091C SCRT_02874 YBR091C YBR091C tr|A6ZL38|A6ZL38_YEAS7 YBR091C YBR091C YBR091C YBR091C YBR091C YBR091C

Jump to [ Top of page · Domain architecture · Domain assignment details ]