SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR097W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR097W
Domain Number 1 Region: 26-296
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.24e-38
Family Protein kinases, catalytic subunit 0.0024
Further Details:      
 
Domain Number 2 Region: 419-540,578-749
Classification Level Classification E-value
Superfamily ARM repeat 1.81e-30
Family HEAT repeat 0.0063
Further Details:      
 
Domain Number 3 Region: 1073-1386,1423-1452
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.73e-27
Family WD40-repeat 0.013
Further Details:      
 

Protein sequence

External link(s) Locus: YBR097W   Protein: S000000301
Sequence length 1454
Comment VPS15 SGDID:S000000301, Chr II from 436945-441309, Verified ORF, "Myristoylated serine/threonine protein kinase involved in vacuolar protein sorting; functions as a membrane-associated complex with Vps34p; active form recruits Vps34p to the Golgi membrane; interacts with the GDP-bound form of Gpa1p"
Sequence
MGAQLSLVVQASPSIAIFSYIDVLEEVHYVSQLNSSRFLKTCKALDPNGEIVIKVFIKPK
DQYSLRPFLQRIRAQSFKLGQLPHVLNYSKLIETNRAGYMIRQHLKNNLYDRLSLRPYLQ
DIELKFIAFQLLNTLKDIHNLNIVHGDIKTENILVTSWNWCILTDFAAFIKPVYLPEDNP
GEFLFYFDTSKRRTCYLAPERFNSKLYQDGKSNNGRLTKEMDIFSLGCVIAEIFAEGRPI
FNLSQLFKYKSNSYDVNREFLMEEMNSTDLRNLVLDMIQLDPSKRLSCDELLNKYRGIFF
PDYFYTFIYDYFRNLVTMTTSTPISDNTCTNSTLEDNVKLLDETTEKIYRDFSQICHCLD
FPLIKDGGEIGSDPPILESYKIEIEISRFLNTNLYFPQNYHLVLQQFTKVSEKIKSVKEE
CALLFISYLSHSIRSIVSTATKLKNLELLAVFAQFVSDENKIDRVVPYFVCCFEDSDQDV
QALSLLTLIQVLTSVRKLNQLNENIFVDYLLPRLKRLLISNRQNTNYLRIVFANCLSDLA
IIINRFQEFTFAQHCNDNSMDNNTEIMESSTKYSAKLIQSVEDLTVSFLTDNDTYVKMAL
LQNILPLCKFFGRERTNDIILSHLITYLNDKDPALRVSLIQTISGISILLGTVTLEQYIL
PLLIQTITDSEELVVISVLQSLKSLFKTGLIRKKYYIDISKTTSPLLLHPNNWIRQFTLM
IIIEIINKLSKAEVYCILYPIIRPFFEFDVEFNFKSMISCCKQPVSRSVYNLLCSWSVRA
SKSLFWKKIITNHVDSFGNNRIEFITKNYSSKNYGFNKRDTKSSSSLKGIKTSSTVYSHD
NKEIPLTAEDINWIDKFHIIGLTEKDIWKIVALRGYVIRTARVMAANPDFPYNNSNYRPL
VQNSPPNLNLTNIMPRNIFFDVEFAEESTSEGQDSNLENQQIYKYDESEKDSNKLNINGS
KQLSTVMDINGSLIFKNKSIATTTSNLKNVFVQLEPTSYHMHSPNHGLKDNANVKPERKV
VVSNSYEGDVESIEKFLSTFKILPPLRDYKEFGPIQEIVRSPNMGNLRGKLIATLMENEP
NSITSSAVSPGETPYLITGSDQGVIKIWNLKEIIVGEVYSSSLTYDCSSTVTQITMIPNF
DAFAVSSKDGQIIVLKVNHYQQESEVKFLNCECIRKINLKNFGKNEYAVRMRAFVNEEKS
LLVALTNLSRVIIFDIRTLERLQIIENSPRHGAVSSICIDEECCVLILGTTRGIIDIWDI
RFNVLIRSWSFGDHAPITHVEVCQFYGKNSVIVVGGSSKTFLTIWNFVKGHCQYAFINSD
EQPSMEHFLPIEKGLEELNFCGIRSLNALSTISVSNDKILLTDEATSSIVMFSLNELSSS
KAVISPSRFSDVFIPTQVTANLTMLLRKMKRTSTHSVDDSLYHHDIINSISTCEVDETPL
LVACDNSGLIGIFQ
Download sequence
Identical sequences YBR097W 4932.YBR097W

Jump to [ Top of page · Domain architecture · Domain assignment details ]