SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR097W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR097W
Domain Number 1 Region: 26-296
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.24e-38
Family Protein kinases, catalytic subunit 0.0024
Further Details:      
 
Domain Number 2 Region: 419-540,578-749
Classification Level Classification E-value
Superfamily ARM repeat 1.81e-30
Family HEAT repeat 0.0063
Further Details:      
 
Domain Number 3 Region: 1073-1386,1423-1452
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.73e-27
Family WD40-repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
transmembrane receptor protein kinase activity 1.703 79.73
adenyl ribonucleotide binding 1.479 38.8
growth factor binding 1.658 35.78
protein transporter activity 2.238 34.64
purine ribonucleoside triphosphate binding 1.453 31.65
purine ribonucleoside binding 1.42 30.59
lyase activity 1.474 26.11
monooxygenase activity 2.214 25.47
oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxyge 2.011 25.47
calmodulin binding 2.026 18.58
Cellular Component IC (bits) H-Score
nucleolus 1.644 36.88
membrane coat 2.107 28.64
trans-Golgi network 1.798 19.21
cilium 1.617 16.76
centrosome 1.802 14.33
spindle pole 2.219 12.57
cytosol 1.308 12.43
mitochondrial envelope 1.579 11.79
mitochondrial membrane part 1.918 11.79
endosome 1.325 10.86
Biological Process IC (bits) H-Score
protein phosphorylation 1.435 203.07
intracellular protein kinase cascade 1.645 65.41
peptidyl-serine modification 2.089 62.47
regulation of MAPK cascade 1.472 54.83
positive regulation of protein phosphorylation 1.472 50.04
positive regulation of intracellular protein kinase cascade 1.338 49.08
positive regulation of transferase activity 1.507 48.38
regulation of cell cycle process 1.539 32.3
cellular response to growth factor stimulus 1.344 31.44
regulation of developmental growth 1.367 31.04

Protein sequence

External link(s) Locus: YBR097W   Protein: S000000301
Sequence length 1454
Comment VPS15 SGDID:S000000301, Chr II from 436945-441309, Verified ORF, "Myristoylated serine/threonine protein kinase involved in vacuolar protein sorting; functions as a membrane-associated complex with Vps34p; active form recruits Vps34p to the Golgi membrane; interacts with the GDP-bound form of Gpa1p"
Sequence
MGAQLSLVVQASPSIAIFSYIDVLEEVHYVSQLNSSRFLKTCKALDPNGEIVIKVFIKPK
DQYSLRPFLQRIRAQSFKLGQLPHVLNYSKLIETNRAGYMIRQHLKNNLYDRLSLRPYLQ
DIELKFIAFQLLNTLKDIHNLNIVHGDIKTENILVTSWNWCILTDFAAFIKPVYLPEDNP
GEFLFYFDTSKRRTCYLAPERFNSKLYQDGKSNNGRLTKEMDIFSLGCVIAEIFAEGRPI
FNLSQLFKYKSNSYDVNREFLMEEMNSTDLRNLVLDMIQLDPSKRLSCDELLNKYRGIFF
PDYFYTFIYDYFRNLVTMTTSTPISDNTCTNSTLEDNVKLLDETTEKIYRDFSQICHCLD
FPLIKDGGEIGSDPPILESYKIEIEISRFLNTNLYFPQNYHLVLQQFTKVSEKIKSVKEE
CALLFISYLSHSIRSIVSTATKLKNLELLAVFAQFVSDENKIDRVVPYFVCCFEDSDQDV
QALSLLTLIQVLTSVRKLNQLNENIFVDYLLPRLKRLLISNRQNTNYLRIVFANCLSDLA
IIINRFQEFTFAQHCNDNSMDNNTEIMESSTKYSAKLIQSVEDLTVSFLTDNDTYVKMAL
LQNILPLCKFFGRERTNDIILSHLITYLNDKDPALRVSLIQTISGISILLGTVTLEQYIL
PLLIQTITDSEELVVISVLQSLKSLFKTGLIRKKYYIDISKTTSPLLLHPNNWIRQFTLM
IIIEIINKLSKAEVYCILYPIIRPFFEFDVEFNFKSMISCCKQPVSRSVYNLLCSWSVRA
SKSLFWKKIITNHVDSFGNNRIEFITKNYSSKNYGFNKRDTKSSSSLKGIKTSSTVYSHD
NKEIPLTAEDINWIDKFHIIGLTEKDIWKIVALRGYVIRTARVMAANPDFPYNNSNYRPL
VQNSPPNLNLTNIMPRNIFFDVEFAEESTSEGQDSNLENQQIYKYDESEKDSNKLNINGS
KQLSTVMDINGSLIFKNKSIATTTSNLKNVFVQLEPTSYHMHSPNHGLKDNANVKPERKV
VVSNSYEGDVESIEKFLSTFKILPPLRDYKEFGPIQEIVRSPNMGNLRGKLIATLMENEP
NSITSSAVSPGETPYLITGSDQGVIKIWNLKEIIVGEVYSSSLTYDCSSTVTQITMIPNF
DAFAVSSKDGQIIVLKVNHYQQESEVKFLNCECIRKINLKNFGKNEYAVRMRAFVNEEKS
LLVALTNLSRVIIFDIRTLERLQIIENSPRHGAVSSICIDEECCVLILGTTRGIIDIWDI
RFNVLIRSWSFGDHAPITHVEVCQFYGKNSVIVVGGSSKTFLTIWNFVKGHCQYAFINSD
EQPSMEHFLPIEKGLEELNFCGIRSLNALSTISVSNDKILLTDEATSSIVMFSLNELSSS
KAVISPSRFSDVFIPTQVTANLTMLLRKMKRTSTHSVDDSLYHHDIINSISTCEVDETPL
LVACDNSGLIGIFQ
Download sequence
Identical sequences YBR097W 4932.YBR097W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]