SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YBR097W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR097W
Domain Number 1 Region: 26-296
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.24e-38
Family Protein kinases, catalytic subunit 0.0024
Further Details:      
 
Domain Number 2 Region: 419-540,578-749
Classification Level Classification E-value
Superfamily ARM repeat 1.81e-30
Family HEAT repeat 0.0063
Further Details:      
 
Domain Number 3 Region: 1073-1386,1423-1452
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.73e-27
Family WD40-repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
membrane coat 2.031 28.1
coated vesicle membrane 2.048 16.89
plasma membrane receptor complex 1.776 12.75
late endosome 1.808 10.57
methyltransferase complex 2.1 10.15
transport vesicle 1.738 9.69
clathrin-coated vesicle 1.946 9.69
transport vesicle membrane 2.001 9.69
cytosolic part 1.704 8.74
mitochondrial envelope 1.596 8.73

Protein sequence

External link(s) Locus: YBR097W   Protein: S000000301
Sequence length 1454
Comment VPS15 SGDID:S000000301, Chr II from 436945-441309, Verified ORF, "Myristoylated serine/threonine protein kinase involved in vacuolar protein sorting; functions as a membrane-associated complex with Vps34p; active form recruits Vps34p to the Golgi membrane; interacts with the GDP-bound form of Gpa1p"
Sequence
MGAQLSLVVQASPSIAIFSYIDVLEEVHYVSQLNSSRFLKTCKALDPNGEIVIKVFIKPK
DQYSLRPFLQRIRAQSFKLGQLPHVLNYSKLIETNRAGYMIRQHLKNNLYDRLSLRPYLQ
DIELKFIAFQLLNTLKDIHNLNIVHGDIKTENILVTSWNWCILTDFAAFIKPVYLPEDNP
GEFLFYFDTSKRRTCYLAPERFNSKLYQDGKSNNGRLTKEMDIFSLGCVIAEIFAEGRPI
FNLSQLFKYKSNSYDVNREFLMEEMNSTDLRNLVLDMIQLDPSKRLSCDELLNKYRGIFF
PDYFYTFIYDYFRNLVTMTTSTPISDNTCTNSTLEDNVKLLDETTEKIYRDFSQICHCLD
FPLIKDGGEIGSDPPILESYKIEIEISRFLNTNLYFPQNYHLVLQQFTKVSEKIKSVKEE
CALLFISYLSHSIRSIVSTATKLKNLELLAVFAQFVSDENKIDRVVPYFVCCFEDSDQDV
QALSLLTLIQVLTSVRKLNQLNENIFVDYLLPRLKRLLISNRQNTNYLRIVFANCLSDLA
IIINRFQEFTFAQHCNDNSMDNNTEIMESSTKYSAKLIQSVEDLTVSFLTDNDTYVKMAL
LQNILPLCKFFGRERTNDIILSHLITYLNDKDPALRVSLIQTISGISILLGTVTLEQYIL
PLLIQTITDSEELVVISVLQSLKSLFKTGLIRKKYYIDISKTTSPLLLHPNNWIRQFTLM
IIIEIINKLSKAEVYCILYPIIRPFFEFDVEFNFKSMISCCKQPVSRSVYNLLCSWSVRA
SKSLFWKKIITNHVDSFGNNRIEFITKNYSSKNYGFNKRDTKSSSSLKGIKTSSTVYSHD
NKEIPLTAEDINWIDKFHIIGLTEKDIWKIVALRGYVIRTARVMAANPDFPYNNSNYRPL
VQNSPPNLNLTNIMPRNIFFDVEFAEESTSEGQDSNLENQQIYKYDESEKDSNKLNINGS
KQLSTVMDINGSLIFKNKSIATTTSNLKNVFVQLEPTSYHMHSPNHGLKDNANVKPERKV
VVSNSYEGDVESIEKFLSTFKILPPLRDYKEFGPIQEIVRSPNMGNLRGKLIATLMENEP
NSITSSAVSPGETPYLITGSDQGVIKIWNLKEIIVGEVYSSSLTYDCSSTVTQITMIPNF
DAFAVSSKDGQIIVLKVNHYQQESEVKFLNCECIRKINLKNFGKNEYAVRMRAFVNEEKS
LLVALTNLSRVIIFDIRTLERLQIIENSPRHGAVSSICIDEECCVLILGTTRGIIDIWDI
RFNVLIRSWSFGDHAPITHVEVCQFYGKNSVIVVGGSSKTFLTIWNFVKGHCQYAFINSD
EQPSMEHFLPIEKGLEELNFCGIRSLNALSTISVSNDKILLTDEATSSIVMFSLNELSSS
KAVISPSRFSDVFIPTQVTANLTMLLRKMKRTSTHSVDDSLYHHDIINSISTCEVDETPL
LVACDNSGLIGIFQ
Download sequence
Identical sequences 4932.YBR097W YBR097W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]