SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YBR103W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR103W
Domain Number 1 Region: 162-492
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.93e-46
Family WD40-repeat 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ubiquitin ligase complex 1.933 42.51
nucleolus 1.652 36.88
methyltransferase complex 2.218 18.65
cilium 1.611 16.73
vacuole 1.428 11.94
nucleoplasm part 1.418 11.42
transcription factor complex 1.882 11.42
cytoplasmic vesicle part 1.738 10.37
cytoplasmic vesicle membrane 1.923 10.37
SWI/SNF superfamily-type complex 2.178 9.97

Protein sequence

External link(s) Locus: YBR103W   Protein: S000000307
Sequence length 535
Comment SIF2 SGDID:S000000307, Chr II from 447703-449310, Verified ORF, "WD40 repeat-containing subunit of the Set3C histone deacetylase complex, which represses early/middle sporulation genes; antagonizes telomeric silencing; binds specifically to the Sir4p N-terminus"
Sequence
MSITSEELNYLIWRYCQEMGHEVSALALQDETRVLEFDEKYKEHIPLGTLVNLVQRGILY
TESELMVDSKGDISALNEHHLSEDFNLVQALQIDKEKFPEISSEGRFTLETNSESNKAGE
DGASTVERETQEDDTNSIDSSDDLDGFVKILKEIVKLDNIVSSTWNPLDESILAYGEKNS
VARLARIVETDQEGKKYWKLTIIAELRHPFALSASSGKTTNQVTCLAWSHDGNSIVTGVE
NGELRLWNKTGALLNVLNFHRAPIVSVKWNKDGTHIISMDVENVTILWNVISGTVMQHFE
LKETGGSSINAENHSGDGSLGVDVEWVDDDKFVIPGPKGAIFVYQITEKTPTGKLIGHHG
PISVLEFNDTNKLLLSASDDGTLRIWHGGNGNSQNCFYGHSQSIVSASWVGDDKVISCSM
DGSVRLWSLKQNTLLALSIVDGVPIFAGRISQDGQKYAVAFMDGQVNVYDLKKLNSKSRS
LYGNRDGILNPLPIPLYASYQSSQDNDYIFDLSWNCAGNKISVAYSLQEGSVVAI
Download sequence
Identical sequences G2W9A8 N1PAS8 P38262
YBR103W YBR103W YBR103W YBR103W YBR103W 4932.YBR103W YBR103W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]