SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR103W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR103W
Domain Number 1 Region: 162-492
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.93e-46
Family WD40-repeat 0.00078
Further Details:      
 

Protein sequence

External link(s) Locus: YBR103W   Protein: S000000307
Sequence length 535
Comment SIF2 SGDID:S000000307, Chr II from 447703-449310, Verified ORF, "WD40 repeat-containing subunit of the Set3C histone deacetylase complex, which represses early/middle sporulation genes; antagonizes telomeric silencing; binds specifically to the Sir4p N-terminus"
Sequence
MSITSEELNYLIWRYCQEMGHEVSALALQDETRVLEFDEKYKEHIPLGTLVNLVQRGILY
TESELMVDSKGDISALNEHHLSEDFNLVQALQIDKEKFPEISSEGRFTLETNSESNKAGE
DGASTVERETQEDDTNSIDSSDDLDGFVKILKEIVKLDNIVSSTWNPLDESILAYGEKNS
VARLARIVETDQEGKKYWKLTIIAELRHPFALSASSGKTTNQVTCLAWSHDGNSIVTGVE
NGELRLWNKTGALLNVLNFHRAPIVSVKWNKDGTHIISMDVENVTILWNVISGTVMQHFE
LKETGGSSINAENHSGDGSLGVDVEWVDDDKFVIPGPKGAIFVYQITEKTPTGKLIGHHG
PISVLEFNDTNKLLLSASDDGTLRIWHGGNGNSQNCFYGHSQSIVSASWVGDDKVISCSM
DGSVRLWSLKQNTLLALSIVDGVPIFAGRISQDGQKYAVAFMDGQVNVYDLKKLNSKSRS
LYGNRDGILNPLPIPLYASYQSSQDNDYIFDLSWNCAGNKISVAYSLQEGSVVAI
Download sequence
Identical sequences G2W9A8 P38262
YBR103W YBR103W 4932.YBR103W YBR103W YBR103W YBR103W YBR103W

Jump to [ Top of page · Domain architecture · Domain assignment details ]