SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YBR103W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR103W
Domain Number 1 Region: 162-492
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.93e-46
Family WD40-repeat 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
regulation of organ morphogenesis 1.692 28.82
regulation of morphogenesis of an epithelium 1.94 28.82
kidney development 1.51 24.61
renal tubule development 2.068 24.61
rRNA metabolic process 2.134 24.37
cilium assembly 1.427 22.48
digestive tract development 2.035 22.18
RNA processing 1.497 18.33
chromosome organization 1.49 16.62
microtubule-based movement 2.011 16.19

Protein sequence

External link(s) Locus: YBR103W   Protein: S000000307
Sequence length 535
Comment SIF2 SGDID:S000000307, Chr II from 447703-449310, Verified ORF, "WD40 repeat-containing subunit of the Set3C histone deacetylase complex, which represses early/middle sporulation genes; antagonizes telomeric silencing; binds specifically to the Sir4p N-terminus"
Sequence
MSITSEELNYLIWRYCQEMGHEVSALALQDETRVLEFDEKYKEHIPLGTLVNLVQRGILY
TESELMVDSKGDISALNEHHLSEDFNLVQALQIDKEKFPEISSEGRFTLETNSESNKAGE
DGASTVERETQEDDTNSIDSSDDLDGFVKILKEIVKLDNIVSSTWNPLDESILAYGEKNS
VARLARIVETDQEGKKYWKLTIIAELRHPFALSASSGKTTNQVTCLAWSHDGNSIVTGVE
NGELRLWNKTGALLNVLNFHRAPIVSVKWNKDGTHIISMDVENVTILWNVISGTVMQHFE
LKETGGSSINAENHSGDGSLGVDVEWVDDDKFVIPGPKGAIFVYQITEKTPTGKLIGHHG
PISVLEFNDTNKLLLSASDDGTLRIWHGGNGNSQNCFYGHSQSIVSASWVGDDKVISCSM
DGSVRLWSLKQNTLLALSIVDGVPIFAGRISQDGQKYAVAFMDGQVNVYDLKKLNSKSRS
LYGNRDGILNPLPIPLYASYQSSQDNDYIFDLSWNCAGNKISVAYSLQEGSVVAI
Download sequence
Identical sequences G2W9A8 N1PAS8 P38262
YBR103W YBR103W YBR103W YBR103W YBR103W 4932.YBR103W YBR103W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]