SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR121C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR121C
Domain Number 1 Region: 15-124,158-289,332-428,499-549
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.43e-123
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 8.98e-06
Further Details:      
 
Domain Number 2 Region: 534-654
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.03e-33
Family Anticodon-binding domain of Class II aaRS 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
nucleolus 1.651 7.22
plastid 1.6 5.45
ribonucleoprotein complex 1.415 4.9
spliceosomal complex 2.017 4.9

Protein sequence

External link(s) Locus: YBR121C   Protein: S000000325
Sequence length 667
Comment GRS1 SGDID:S000000325, Chr II from 483361-481358, reverse complement, Verified ORF, "Cytoplasmic and mitochondrial glycyl-tRNA synthase that ligates glycine to the cognate anticodon bearing tRNA; transcription termination factor that may interact with the 3'-end of pre-mRNA to promote 3'-end formation"
Sequence
MSVEDIKKARAAVPFNREQLESVLRGRFFYAPAFDLYGGVSGLYDYGPPGCAFQNNIIDA
WRKHFILEEDMLEVDCTMLTPYEVLKTSGHVDKFSDWMCRDLKTGEIFRADHLVEEVLEA
RLKGDQEARGLVEDANAAAKDDAEKKKRKKKVKQIKAVKLDDDVVKEYEEILAKIDGYSG
PELGELMEKYDIGNPVTGETLESPRAFNLMFETAIGPSGQLKGYLRPETAQGQFLNFNKL
LEFNNSKTPFASASIGKSFRNEISPRAGLLRVREFLMAEIEHFVDPLDKSHPKFNEIKDI
KLSFLPRDVQEAGSTEPIVKTVGEAVASRMVDNETLGYFIARIYQFLMKIGVDESKLRFR
QHMANEMAHYAADCWDGELKTSYGWIECVGCADRSAYDLTVHSKKTKEKLVVRQKLDNPI
EVTKWEIDLTKKLFGPKFRKDAPKVESHLLNMSQDDLASKAELLKANGKFTIKVDGVDGE
VELDDKLVKIEQRTKVEHVREYVPSVIEPSFGIGRIIYSVFEHSFWNRPEDNARSVLSFP
PLVAPTKVLLVPLSNHKDLVPVHHEVAKILRKSQIPFKIDDSGVSIGKRYARNDELGTPF
GVTIDFESAKDHSVTLRERDSTKQVRGSVENVIKAIRDITYNGASWEEGTKDLTPFIAQA
EAEAETD
Download sequence
Identical sequences YBR121C 4932.YBR121C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]