SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR121C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR121C
Domain Number 1 Region: 15-124,158-289,332-428,499-549
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.43e-123
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 8.98e-06
Further Details:      
 
Domain Number 2 Region: 534-654
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.03e-33
Family Anticodon-binding domain of Class II aaRS 0.00081
Further Details:      
 

Protein sequence

External link(s) Locus: YBR121C   Protein: S000000325
Sequence length 667
Comment GRS1 SGDID:S000000325, Chr II from 483361-481358, reverse complement, Verified ORF, "Cytoplasmic and mitochondrial glycyl-tRNA synthase that ligates glycine to the cognate anticodon bearing tRNA; transcription termination factor that may interact with the 3'-end of pre-mRNA to promote 3'-end formation"
Sequence
MSVEDIKKARAAVPFNREQLESVLRGRFFYAPAFDLYGGVSGLYDYGPPGCAFQNNIIDA
WRKHFILEEDMLEVDCTMLTPYEVLKTSGHVDKFSDWMCRDLKTGEIFRADHLVEEVLEA
RLKGDQEARGLVEDANAAAKDDAEKKKRKKKVKQIKAVKLDDDVVKEYEEILAKIDGYSG
PELGELMEKYDIGNPVTGETLESPRAFNLMFETAIGPSGQLKGYLRPETAQGQFLNFNKL
LEFNNSKTPFASASIGKSFRNEISPRAGLLRVREFLMAEIEHFVDPLDKSHPKFNEIKDI
KLSFLPRDVQEAGSTEPIVKTVGEAVASRMVDNETLGYFIARIYQFLMKIGVDESKLRFR
QHMANEMAHYAADCWDGELKTSYGWIECVGCADRSAYDLTVHSKKTKEKLVVRQKLDNPI
EVTKWEIDLTKKLFGPKFRKDAPKVESHLLNMSQDDLASKAELLKANGKFTIKVDGVDGE
VELDDKLVKIEQRTKVEHVREYVPSVIEPSFGIGRIIYSVFEHSFWNRPEDNARSVLSFP
PLVAPTKVLLVPLSNHKDLVPVHHEVAKILRKSQIPFKIDDSGVSIGKRYARNDELGTPF
GVTIDFESAKDHSVTLRERDSTKQVRGSVENVIKAIRDITYNGASWEEGTKDLTPFIAQA
EAEAETD
Download sequence
Identical sequences YBR121C 4932.YBR121C

Jump to [ Top of page · Domain architecture · Domain assignment details ]