SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YBR126C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR126C
Domain Number 1 Region: 17-482
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 1.41e-167
Family Trehalose-6-phosphate synthase, OtsA 0.000000199
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YBR126C   Protein: S000000330
Sequence length 495
Comment TPS1 SGDID:S000000330, Chr II from 490386-488899, reverse complement, Verified ORF, "Synthase subunit of trehalose-6-phosphate synthase/phosphatase complex, which synthesizes the storage carbohydrate trehalose; also found in a monomeric form; expression is induced by the stress response and repressed by the Ras-cAMP pathway"
Sequence
MTTDNAKAQLTSSSGGNIIVVSNRLPVTITKNSSTGQYEYAMSSGGLVTALEGLKKTYTF
KWFGWPGLEIPDDEKDQVRKDLLEKFNAVPIFLSDEIADLHYNGFSNSILWPLFHYHPGE
INFDENAWLAYNEANQTFTNEIAKTMNHNDLIWVHDYHLMLVPEMLRVKIHEKQLQNVKV
GWFLHTPFPSSEIYRILPVRQEILKGVLSCDLVGFHTYDYARHFLSSVQRVLNVNTLPNG
VEYQGRFVNVGAFPIGIDVDKFTDGLKKESVQKRIQQLKETFKGCKIIVGVDRLDYIKGV
PQKLHAMEVFLNEHPEWRGKVVLVQVAVPSRGDVEEYQYLRSVVNELVGRINGQFGTVEF
VPIHFMHKSIPFEELISLYAVSDVCLVSSTRDGMNLVSYEYIACQEEKKGSLILSEFTGA
AQSLNGAIIVNPWNTDDLSDAINEALTLPDVKKEVNWEKLYKYISKYTSAFWGENFVHEL
YSTSSSSTSSSATKN
Download sequence
Identical sequences A0A0L8VV78 A6ZL70 B3LN30 C7GY09 D3UEL8 E7K9X4 E7KKD9 E7QBH1 G2W9D0 G4XSR1 H0GCI0 N1PAT3 Q00764
YBR126C YBR126C YBR126C 4932.YBR126C YBR126C YBR126C YBR126C YBR126C 354966 NP_009684.1.97178 YBR126C YBR126C YBR126C YBR126C tr|A6ZL70|A6ZL70_YEAS7 YBR126C YBR126C YBR126C YBR126C SCRT_02843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]