SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR127C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR127C
Domain Number 1 Region: 101-386
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.5e-85
Family RecA protein-like (ATPase-domain) 3.65e-05
Further Details:      
 
Weak hits

Sequence:  YBR127C
Domain Number - Region: 27-89
Classification Level Classification E-value
Superfamily N-terminal domain of alpha and beta subunits of F1 ATP synthase 0.0416
Family N-terminal domain of alpha and beta subunits of F1 ATP synthase 0.017
Further Details:      
 
Domain Number - Region: 393-466
Classification Level Classification E-value
Superfamily C-terminal domain of alpha and beta subunits of F1 ATP synthase 0.0463
Family C-terminal domain of alpha and beta subunits of F1 ATP synthase 0.0065
Further Details:      
 

Protein sequence

External link(s) Locus: YBR127C   Protein: S000000331
Sequence length 517
Comment VMA2 SGDID:S000000331, Chr II from 492816-491263, reverse complement, Verified ORF, "Subunit B of the eight-subunit V1 peripheral membrane domain of the vacuolar H+-ATPase (V-ATPase), an electrogenic proton pump found throughout the endomembrane system; contains nucleotide binding sites; also detected in the cytoplasm"
Sequence
MVLSDKELFAINKKAVEQGFNVKPRLNYNTVSGVNGPLVILEKVKFPRYNEIVNLTLPDG
TVRQGQVLEIRGDRAIVQVFEGTSGIDVKKTTVEFTGESLRIPVSEDMLGRIFDGSGRPI
DNGPKVFAEDYLDINGSPINPYARIYPEEMISTGVSAIDTMNSIARGQKIPIFSASGLPH
NEIAAQICRQAGLVRPTKDVHDGHEENFSIVFAAMGVNLETARFFKQDFEENGSLERTSL
FLNLANDPTIERIITPRLALTTAEYLAYQTERHVLTILTDMSSYADALREVSAAREEVPG
RRGYPGYMYTDLSTIYERAGRVEGRNGSITQIPILTMPNDDITHPIPDLTGYITEGQIFV
DRQLHNKGIYPPINVLPSLSRLMKSAIGEGMTRKDHGDVSNQLYAKYAIGKDAAAMKAVV
GEEALSIEDKLSLEFLEKFEKTFITQGAYEDRTVFESLDQAWSLLRIYPKEMLNRISPKI
LDEFYDRARDDADEDEEDPDTRSSGKKKDASQEESLI
Download sequence
Identical sequences A6ZL71 B3LN29 C7GY10 D3UEM1 E7K9X5 E7KKE0 E7LRK7 E7NEX6 E7Q0Z5 E7QBH2 G2W9D1 H0GCI1 P16140
YBR127C YBR127C YBR127C YBR127C YBR127C YBR127C YBR127C YBR127C YBR127C 4932.YBR127C YBR127C SCRT_02842 YBR127C YBR127C tr|A6ZL71|A6ZL71_YEAS7 YBR127C YBR127C YBR127C YBR127c___KOG1351 YBR127C YBR127C YBR127C YBR127C

Jump to [ Top of page · Domain architecture · Domain assignment details ]