SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR135W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR135W
Domain Number 1 Region: 8-115
Classification Level Classification E-value
Superfamily Cell cycle regulatory proteins 4.45e-46
Family Cell cycle regulatory proteins 5.43e-07
Further Details:      
 

Protein sequence

External link(s) Locus: YBR135W   Protein: S000000339
Sequence length 150
Comment CKS1 SGDID:S000000339, Chr II from 504848-505300, Verified ORF, "Cyclin-dependent protein kinase regulatory subunit and adaptor; modulates proteolysis of M-phase targets through interactions with the proteasome; role in transcriptional regulation, recruiting proteasomal subunits to target gene promoters"
Sequence
MYHHYHAFQGRKLTDQERARVLEFQDSIHYSPRYSDDNYEYRHVMLPKAMLKVIPSDYFN
SEVGTLRILTEDEWRGLGITQSLGWEHYECHAPEPHILLFKRPLNYEAELRAATAAAQQQ
QQQQQQQQQQQQQHQTQSISNDMQVPPQIS
Download sequence
Identical sequences A6ZL78 C7GY17 D3UEM9 E7K9Y0 E7KKE6 E7LRL2 E7QBH7 G2W9D8 H0GCK0 P20486
YBR135W 1qb3A YBR135W YBR135W YBR135W YBR135W YBR135W YT4 YBR135W YBR135W 4932.YBR135W YBR135W YBR135W YBR135W tr|A6ZL78|A6ZL78_YEAS7 1qb3.A 1qb3.B 1qb3.C YBR135W YBR135W YBR135W YBR135W YBR135W YBR135W

Jump to [ Top of page · Domain architecture · Domain assignment details ]