SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR141W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YBR141W-A   Protein: S000028602
Sequence length 31
Comment YBR141W-A SGDID:S000028602, Chr II from 527161-527256, Dubious ORF, "Dubious ORF unlikely to encode a protein, based on available experimental and comparative sequence data; overlaps the uncharacterized ORF YBR141C; identified by gene-trapping, microarray analysis, and genome-wide homology searching"
Sequence
MSPIEPRRFCNSVLSQYLECVTQACGRTIKM
Download sequence
Identical sequences D3UEN6 Q8TGQ4
YBR141W-A YBR141W-A YBR141W-A YBR141W-A YBR141W-A YBR141W-A YBR141W-A YBR141W-A YBR141W-A YBR141W-A YBR141W-A YBR141W-A YBR141W-A YBR141W-A 4932.YBR141W-A YBR141W-A YBR141W-A YBR141W-A YBR141W-A YBR141W-A YBR141W-A YBR141W-A YBR141W-A YBR141W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]