SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR141W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YBR141W-A   Protein: S000028602
Sequence length 31
Comment YBR141W-A SGDID:S000028602, Chr II from 527161-527256, Dubious ORF, "Dubious ORF unlikely to encode a protein, based on available experimental and comparative sequence data; overlaps the uncharacterized ORF YBR141C; identified by gene-trapping, microarray analysis, and genome-wide homology searching"
Sequence
MSPIEPRRFCNSVLSQYLECVTQACGRTIKM
Download sequence
Identical sequences D3UEN6 Q8TGQ4
YBR141W-A YBR141W-A YBR141W-A YBR141W-A YBR141W-A YBR141W-A YBR141W-A YBR141W-A YBR141W-A YBR141W-A YBR141W-A YBR141W-A YBR141W-A 4932.YBR141W-A YBR141W-A YBR141W-A YBR141W-A YBR141W-A YBR141W-A YBR141W-A YBR141W-A YBR141W-A YBR141W-A YBR141W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]