SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR150C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR150C
Domain Number 1 Region: 97-144
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 1.96e-10
Family Zn2/Cys6 DNA-binding domain 0.0011
Further Details:      
 
Weak hits

Sequence:  YBR150C
Domain Number - Region: 300-353
Classification Level Classification E-value
Superfamily Colicin E immunity proteins 0.0641
Family Colicin E immunity proteins 0.0099
Further Details:      
 

Protein sequence

External link(s) Locus: YBR150C   Protein: S000000354
Sequence length 1094
Comment TBS1 SGDID:S000000354, Chr II from 544487-541203, reverse complement, Verified ORF, "Putative protein of unknown function; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies"
Sequence
MNMDSGITSSHGSMDKTQKQSSEWAANQKHNQRVENTRVLMGPAVPAMPPVPSNFPPVPT
GTIMSPQLSPFPDHRLRHHPLAHMMPADKNFLAYNMESFKSRVTKACDYCRKRKIRCTEI
EPISGKCRNCIKYNKDCTFHFHEELKRRREEALNNKGNGKSVKKPRLDKENKFKDENFDI
AVRSRNTSSTDSSPKLHTNLSQEYIGVSAGKSASDKEDTWPDFVPIDRTVLEKIELNHTK
VAGKVFVLEEICKNMKGTIEKLAEKSKIDVIDKEYMKRPKRKQYSKALLTKQKMFHFRQN
VLSHLTDEEFLSPINEMFTTTFKYSILQTKLVLDFSFRSASSPSSDNILYPLPRLAIAKR
LLKNIKCPSLASLLHIVDVDQCLQFADVHFDPAKGRLTSSQAFLLNICLCLGATVTNFEE
KQELVDEDNHETYYFEKFELWRLRSFTFLNSVYYYHKLSVARADMTALKALLLLAKFAQQ
KISASSAVKVLSVAIKVALDLRLNLHSTYEDLELDEIIKRRRLWCYCFSTDKFFSVVLSR
PPFLKEENTDVLTDESYVELFRDKILPNLSIKYDDSKLEGVKDIVSVVNLLANHLEYVPY
IQSYFLSRLSLIESQIYYSCFSIRTTLDDTLDEIIENVLENQKALDRMRDDLPTILSLEN
YKENMRILSLDSSKLDFEVSCCTTILLHLRWYHQKITLSLFVISIIGDNLDQRESSRHDI
AEIIRRSRLDFKRNCIEVLNILKDFEYYPTVQNEFLYFSLTTVFSMFLYLSEIMVNDEHA
METGYIIGLLRDTHTRMLGSEERCLSVHNLKWQTSLFFYTFFLRSTMEKFNLTSKYAKFY
AFDSNYYEGVLNRLVKHTRESKDDMVELLKTSFINKEKMAAFGSFVTEDQEKMEVSFNIF
NEITIQDLNFLQFSSIPKLWENKTLEPGEEYHHSNGTNTDNNETTGADDTDDNNNNNNNN
NKNGNNSSSTINNNNNNYSNSNNNDNDNNINDDDDDDDDDDDDDDDDDDDDDNDDDYSNN
GADDDEEDDDYDRSLFPTGLASLLDASYPERTANDYRDENEQSNKLFEKIEGHLEHGVFF
YDRDFFFKNVCVKM
Download sequence
Identical sequences P38114
YBR150C YBR150C 4932.YBR150C YBR150C YBR150C YBR150C

Jump to [ Top of page · Domain architecture · Domain assignment details ]