SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR150C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR150C
Domain Number 1 Region: 97-144
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 1.96e-10
Family Zn2/Cys6 DNA-binding domain 0.0011
Further Details:      
 
Weak hits

Sequence:  YBR150C
Domain Number - Region: 300-353
Classification Level Classification E-value
Superfamily Colicin E immunity proteins 0.0641
Family Colicin E immunity proteins 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YBR150C   Protein: S000000354
Sequence length 1094
Comment TBS1 SGDID:S000000354, Chr II from 544487-541203, reverse complement, Verified ORF, "Putative protein of unknown function; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies"
Sequence
MNMDSGITSSHGSMDKTQKQSSEWAANQKHNQRVENTRVLMGPAVPAMPPVPSNFPPVPT
GTIMSPQLSPFPDHRLRHHPLAHMMPADKNFLAYNMESFKSRVTKACDYCRKRKIRCTEI
EPISGKCRNCIKYNKDCTFHFHEELKRRREEALNNKGNGKSVKKPRLDKENKFKDENFDI
AVRSRNTSSTDSSPKLHTNLSQEYIGVSAGKSASDKEDTWPDFVPIDRTVLEKIELNHTK
VAGKVFVLEEICKNMKGTIEKLAEKSKIDVIDKEYMKRPKRKQYSKALLTKQKMFHFRQN
VLSHLTDEEFLSPINEMFTTTFKYSILQTKLVLDFSFRSASSPSSDNILYPLPRLAIAKR
LLKNIKCPSLASLLHIVDVDQCLQFADVHFDPAKGRLTSSQAFLLNICLCLGATVTNFEE
KQELVDEDNHETYYFEKFELWRLRSFTFLNSVYYYHKLSVARADMTALKALLLLAKFAQQ
KISASSAVKVLSVAIKVALDLRLNLHSTYEDLELDEIIKRRRLWCYCFSTDKFFSVVLSR
PPFLKEENTDVLTDESYVELFRDKILPNLSIKYDDSKLEGVKDIVSVVNLLANHLEYVPY
IQSYFLSRLSLIESQIYYSCFSIRTTLDDTLDEIIENVLENQKALDRMRDDLPTILSLEN
YKENMRILSLDSSKLDFEVSCCTTILLHLRWYHQKITLSLFVISIIGDNLDQRESSRHDI
AEIIRRSRLDFKRNCIEVLNILKDFEYYPTVQNEFLYFSLTTVFSMFLYLSEIMVNDEHA
METGYIIGLLRDTHTRMLGSEERCLSVHNLKWQTSLFFYTFFLRSTMEKFNLTSKYAKFY
AFDSNYYEGVLNRLVKHTRESKDDMVELLKTSFINKEKMAAFGSFVTEDQEKMEVSFNIF
NEITIQDLNFLQFSSIPKLWENKTLEPGEEYHHSNGTNTDNNETTGADDTDDNNNNNNNN
NKNGNNSSSTINNNNNNYSNSNNNDNDNNINDDDDDDDDDDDDDDDDDDDDDNDDDYSNN
GADDDEEDDDYDRSLFPTGLASLLDASYPERTANDYRDENEQSNKLFEKIEGHLEHGVFF
YDRDFFFKNVCVKM
Download sequence
Identical sequences N1P9I0 P38114
YBR150C YBR150C 4932.YBR150C YBR150C YBR150C YBR150C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]