SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YBR160W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR160W
Domain Number 1 Region: 6-297
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.12e-96
Family Protein kinases, catalytic subunit 0.00000000776
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YBR160W   Protein: S000000364
Sequence length 298
Comment CDC28 SGDID:S000000364, Chr II from 560072-560968, Verified ORF, "Catalytic subunit of the main cell cycle cyclin-dependent kinase (CDK); alternately associates with G1 cyclins (CLNs) and G2/M cyclins (CLBs) which direct the CDK to specific substrates"
Sequence
MSGELANYKRLEKVGEGTYGVVYKALDLRPGQGQRVVALKKIRLESEDEGVPSTAIREIS
LLKELKDDNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMEGIPKDQPLGADIVKKFMMQL
CKGIAYCHSHRILHRDLKPQNLLINKDGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAP
EVLLGGKQYSTGVDTWSIGCIFAEMCNRKPIFSGDSEIDQIFKIFRVLGTPNEAIWPDIV
YLPDFKPSFPQWRRKDLSQVVPSLDPRGIDLLDKLLAYDPINRISARRAAIHPYFQES
Download sequence
Identical sequences A0A0L8VVJ6 A0A250WG87 A6ZLA2 B3LMZ9 C7GUU4 D3UEQ4 E7K9E3 E7LRM9 E7QBJ5 G2W9G2 H0GCM2 N1P6U1 P00546
YBR160W YBR160W YBR160W YBR160W YBR160W YBR160W NP_009718.3.97178 SCRT_02811 YBR160W YBR160W YBR160W 4932.YBR160W YBR160W YBR160W YBR160W tr|A6ZLA2|A6ZLA2_YEAS7 YBR160W YBR160W YBR160W YBR160W YBR160W YBR160W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]