SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR160W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR160W
Domain Number 1 Region: 6-297
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.12e-96
Family Protein kinases, catalytic subunit 0.00000000776
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
spindle 1.789 20.41
centrosome 1.793 14.51
cytosol 1.301 13.09
synapse part 1.451 11.52
axon 1.505 9.91
neuron projection terminus 2.132 9.91
chromosomal part 1.477 9.63
microtubule associated complex 1.998 9.07
transferase complex 1.423 8.89
nuclear chromosome 1.73 8.54

Protein sequence

External link(s) Locus: YBR160W   Protein: S000000364
Sequence length 298
Comment CDC28 SGDID:S000000364, Chr II from 560072-560968, Verified ORF, "Catalytic subunit of the main cell cycle cyclin-dependent kinase (CDK); alternately associates with G1 cyclins (CLNs) and G2/M cyclins (CLBs) which direct the CDK to specific substrates"
Sequence
MSGELANYKRLEKVGEGTYGVVYKALDLRPGQGQRVVALKKIRLESEDEGVPSTAIREIS
LLKELKDDNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMEGIPKDQPLGADIVKKFMMQL
CKGIAYCHSHRILHRDLKPQNLLINKDGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAP
EVLLGGKQYSTGVDTWSIGCIFAEMCNRKPIFSGDSEIDQIFKIFRVLGTPNEAIWPDIV
YLPDFKPSFPQWRRKDLSQVVPSLDPRGIDLLDKLLAYDPINRISARRAAIHPYFQES
Download sequence
Identical sequences A6ZLA2 B3LMZ9 C7GUU4 D3UEQ4 E7K9E3 E7LRM9 E7QBJ5 G2W9G2 H0GCM2 N1P6U1 P00546 W7PZ72 W7R1I6
YBR160W 4932.YBR160W YBR160W YBR160W SCRT_02811 YBR160W tr|A6ZLA2|A6ZLA2_YEAS7 YBR160W YBR160W YBR160W YBR160W YBR160W YBR160W YBR160W YBR160W YBR160W YBR160W YBR160W YBR160W YBR160W YBR160W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]