SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR181C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YBR181C   Protein: S000000385
Sequence length 236
Comment RPS6B SGDID:S000000385, Chr II from 592769-592764,592411-591707, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps6Ap and has similarity to rat S6 ribosomal protein"
Sequence
MKLNISYPVNGSQKTFEIDDEHRIRVFFDKRIGQEVDGEAVGDEFKGYVFKISGGNDKQG
FPMKQGVLLPTRIKLLLTKNVSCYRPRRDGERKRKSVRGAIVGPDLAVLALVIVKKGEQE
LEGLTDTTVPKRLGPKRANNIRKFFGLSKEDDVRDFVIRREVTKGEKTYTKAPKIQRLVT
PQRLQRKRHQRALKVRNAQAQREAAAEYAQLLAKRLSERKAEKAEIRKRRASSLKA
Download sequence
Identical sequences A6ZLC2 D3UES5 G2WP91 P0CX37 P0CX38
YBR181C YPL090C YBR181C YPL090C YBR181C YPL090C YBR181C YPL090C YBR181C YPL090C YBR181C YPL090C YBR181C YBR181C YPL090C YBR181C YPL090C YR94 YBR181C YPL090C YPL090C YPL090C YBR181C YPL090C 4932.YBR181C 4932.YPL090C YBR181C YPL090C YPL090C YBR181C YPL090C tr|A6ZLC2|A6ZLC2_YEAS7 YBR181C 1vw9.H 1vwv.H 1vxw.G 1vxz.G 3j16.C 3u5c.G 3u5g.G 4byl.G 4byt.G YBR181C YPL090C YBR181c___KOG1646 YBR181C YPL090C YBR181C YPL090C YBR181C YPL090C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]