SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YBR187W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YBR187W
Domain Number - Region: 65-83,174-277
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0248
Family Calcium ATPase, transmembrane domain M 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YBR187W   Protein: S000000391
Sequence length 280
Comment GDT1 SGDID:S000000391, Chr II from 602629-603471, Uncharacterized ORF, "Putative protein of unknown function; expression is reduced in a gcr1 null mutant; GFP-fusion protein localizes to the vacuole; expression pattern and physical interactions suggest a possible role in ribosome biogenesis"
Sequence
MGNMIKKASLIALLPLFTAAAAAATDAETSMESGSSSHLKSFLMSVSMIGLSEIGDKTFL
IAALMAMRHKRVLVFSAAATSLAIMTILSGVVGHSAVAFLSERYTAFFAGILFLVFGYKL
TMEGLEMSKDAGVEEEMAEVEEEIAIKDMNQDMDDVEKGGDTAYDKQLKNASIGKKIVHR
IRELASFMFSPVWVQIFLMVFLGELGDRSQISIIAMATDSDYWYVIAGAVIGHAICSGLA
VVGGKLLATRISIRTITLASSLLFFIFALMYIYQAFTTQD
Download sequence
Identical sequences N1P8M2 P38301
YBR187W YBR187W YBR187W YBR187W 4932.YBR187W YBR187W YBR187W YBR187W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]