SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR187W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YBR187W
Domain Number - Region: 65-83,174-277
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0248
Family Calcium ATPase, transmembrane domain M 0.041
Further Details:      
 

Protein sequence

External link(s) Locus: YBR187W   Protein: S000000391
Sequence length 280
Comment GDT1 SGDID:S000000391, Chr II from 602629-603471, Uncharacterized ORF, "Putative protein of unknown function; expression is reduced in a gcr1 null mutant; GFP-fusion protein localizes to the vacuole; expression pattern and physical interactions suggest a possible role in ribosome biogenesis"
Sequence
MGNMIKKASLIALLPLFTAAAAAATDAETSMESGSSSHLKSFLMSVSMIGLSEIGDKTFL
IAALMAMRHKRVLVFSAAATSLAIMTILSGVVGHSAVAFLSERYTAFFAGILFLVFGYKL
TMEGLEMSKDAGVEEEMAEVEEEIAIKDMNQDMDDVEKGGDTAYDKQLKNASIGKKIVHR
IRELASFMFSPVWVQIFLMVFLGELGDRSQISIIAMATDSDYWYVIAGAVIGHAICSGLA
VVGGKLLATRISIRTITLASSLLFFIFALMYIYQAFTTQD
Download sequence
Identical sequences N1P8M2 P38301
YBR187W 4932.YBR187W YBR187W YBR187W YBR187W YBR187W YBR187W YBR187W

Jump to [ Top of page · Domain architecture · Domain assignment details ]