SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YBR189W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR189W
Domain Number 1 Region: 10-164
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 3.34e-33
Family Ribosomal protein S4 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ribosomal subunit 1.948 10.55
intracellular ribonucleoprotein complex 1.323 8.52
mitochondrial matrix 1.568 8.09
mitochondrial ribosome 2.079 8.09
cytosolic ribosome 2.062 5.47
cytosolic part 1.678 5.32
Molecular Function IC (bits) H-Score
aminoacyl-tRNA ligase activity 1.893 105.58
intramolecular transferase activity 2.107 29.62
isomerase activity 1.598 14.22
structural constituent of ribosome 1.965 13.35
RNA binding 1.279 4.24
Biological Process IC (bits) H-Score
RNA processing 1.497 74.65
ncRNA processing 1.821 74.65
ribosome biogenesis 1.945 25.45
RNA modification 2.202 12.04
translation 1.516 9.07
ncRNA metabolic process 1.499 6.29
mitochondrion organization 1.534 4.5
mitochondrial RNA metabolic process 2.241 4.26
rRNA metabolic process 2.134 3.57
tRNA aminoacylation for protein translation 1.966 3.42

Protein sequence

External link(s) Locus: YBR189W   Protein: S000000393
Sequence length 195
Comment RPS9B SGDID:S000000393, Chr II from 604503-604509,604923-605503, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps9Ap and has similarity to E. coli S4 and rat S9 ribosomal proteins"
Sequence
MPRAPRTYSKTYSTPKRPYESSRLDAELKLAGEFGLKNKREIYRISFQLSKIRRAARDLL
TRDEKDPKRLFEGNALIRRLVRVGVLSEDKKKLDYVLALKVEDFLERRLQTQVYKLGLAK
SVHHARVLITQRHIAVGKQIVNIPSFMVRLDSEKHIDFAPTSPFGGARPGRVARRNAARK
AEASGEAAEEAEDEE
Download sequence
Identical sequences N1P8D7 P05755
4932.YBR189W YBR189W YBR189W YBR189w___KOG3301 YBR189W YBR189W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]