SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YBR189W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR189W
Domain Number 1 Region: 10-164
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 3.34e-33
Family Ribosomal protein S4 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
tRNA aminoacylation for protein translation 1.941 109.54
RNA processing 1.499 74.68
ncRNA processing 1.837 74.68
rRNA metabolic process 2.071 74.68
ribosome biogenesis 1.853 27.25
ribonucleoprotein complex biogenesis 1.7 23.29
RNA modification 2.218 11.81
translation 1.514 9.92
ncRNA metabolic process 1.491 6.2
Molecular Function IC (bits) H-Score
aminoacyl-tRNA ligase activity 1.831 109.54
intramolecular transferase activity 2.132 29.37
structural constituent of ribosome 1.959 17.36
isomerase activity 1.595 13.99
Cellular Component IC (bits) H-Score
ribosomal subunit 1.983 11.43
intracellular ribonucleoprotein complex 1.368 8.93
mitochondrial matrix 1.611 7.47
cytosol 1.295 6.36
organellar ribosome 2.107 6.24
cytosolic ribosome 2.235 4.67

Protein sequence

External link(s) Locus: YBR189W   Protein: S000000393
Sequence length 195
Comment RPS9B SGDID:S000000393, Chr II from 604503-604509,604923-605503, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps9Ap and has similarity to E. coli S4 and rat S9 ribosomal proteins"
Sequence
MPRAPRTYSKTYSTPKRPYESSRLDAELKLAGEFGLKNKREIYRISFQLSKIRRAARDLL
TRDEKDPKRLFEGNALIRRLVRVGVLSEDKKKLDYVLALKVEDFLERRLQTQVYKLGLAK
SVHHARVLITQRHIAVGKQIVNIPSFMVRLDSEKHIDFAPTSPFGGARPGRVARRNAARK
AEASGEAAEEAEDEE
Download sequence
Identical sequences N1P8D7 P05755
YBR189W YBR189W YBR189W 4932.YBR189W YBR189w___KOG3301 YBR189W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]