SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR189W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR189W
Domain Number 1 Region: 10-164
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 3.34e-33
Family Ribosomal protein S4 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
aminoacyl-tRNA ligase activity 1.982 89.61
intramolecular transferase activity 2.226 25.26
structural constituent of ribosome 1.982 13.79
isomerase activity 1.671 12.17
RNA binding 1.36 4.12
Cellular Component IC (bits) H-Score
ribosomal subunit 2.011 13.49
ribonucleoprotein complex 1.418 11.17
organellar ribosome 2.15 7.99
cytosol 1.307 6.58
mitochondrial matrix 1.707 4.2
cytosolic ribosome 2.218 3.96
Biological Process IC (bits) H-Score
RNA processing 1.458 74.1
rRNA metabolic process 2.197 74.1
ncRNA processing 1.877 74.1
ribosome biogenesis 2.067 21.02
tRNA aminoacylation 2.002 17.3
RNA modification 2.178 9.97
translation 1.521 9.15
ncRNA metabolic process 1.572 6.33
mitochondrion organization 1.55 4.79

Protein sequence

External link(s) Locus: YBR189W   Protein: S000000393
Sequence length 195
Comment RPS9B SGDID:S000000393, Chr II from 604503-604509,604923-605503, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps9Ap and has similarity to E. coli S4 and rat S9 ribosomal proteins"
Sequence
MPRAPRTYSKTYSTPKRPYESSRLDAELKLAGEFGLKNKREIYRISFQLSKIRRAARDLL
TRDEKDPKRLFEGNALIRRLVRVGVLSEDKKKLDYVLALKVEDFLERRLQTQVYKLGLAK
SVHHARVLITQRHIAVGKQIVNIPSFMVRLDSEKHIDFAPTSPFGGARPGRVARRNAARK
AEASGEAAEEAEDEE
Download sequence
Identical sequences N1P8D7 P05755
YBR189W YBR189W 4932.YBR189W YBR189w___KOG3301 YBR189W YBR189W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]