SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR189W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR189W
Domain Number 1 Region: 10-164
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 3.34e-33
Family Ribosomal protein S4 0.007
Further Details:      
 

Protein sequence

External link(s) Locus: YBR189W   Protein: S000000393
Sequence length 195
Comment RPS9B SGDID:S000000393, Chr II from 604503-604509,604923-605503, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps9Ap and has similarity to E. coli S4 and rat S9 ribosomal proteins"
Sequence
MPRAPRTYSKTYSTPKRPYESSRLDAELKLAGEFGLKNKREIYRISFQLSKIRRAARDLL
TRDEKDPKRLFEGNALIRRLVRVGVLSEDKKKLDYVLALKVEDFLERRLQTQVYKLGLAK
SVHHARVLITQRHIAVGKQIVNIPSFMVRLDSEKHIDFAPTSPFGGARPGRVARRNAARK
AEASGEAAEEAEDEE
Download sequence
Identical sequences N1P8D7 P05755
YBR189W YBR189W 4932.YBR189W YBR189w___KOG3301 YBR189W YBR189W

Jump to [ Top of page · Domain architecture · Domain assignment details ]