SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YBR193C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YBR193C   Protein: S000000397
Sequence length 223
Comment MED8 SGDID:S000000397, Chr II from 609748-609077, reverse complement, Verified ORF, "Subunit of the RNA polymerase II mediator complex; associates with core polymerase subunits to form the RNA polymerase II holoenzyme; essential for transcriptional regulation"
Sequence
MSQSTASLVPEGNQGSLQEDVSFDFNGVPGQALDAVRMRLAQLTHSLRRIRDEMSKAELP
QWYTLQSQLNVTLSQLVSVTSTLQHFQETLDSTVVYPLPKFPTTSHESLVTTLLRKKNIP
EVDEWMKYVRETSGVTTALLKDEEIEKLLQQDREITNWARTTFRNEYGKHDFKNEESLSE
EHASLLVRDSKPSKPFNVDDVLKFTFTGEKPIITGSTSTSSSN
Download sequence
Identical sequences G2W9J4 N1P9K0 P38304
YBR193C YBR193C YBR193C YBR193C YBR193C YBR193C 4932.YBR193C YBR193C YBR193C YBR193C YBR193C YBR193C YBR193C 3j1o.J 3rj1.C 3rj1.J 3rj1.Q Pf-sce:YBR193C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]