SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR193C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YBR193C   Protein: S000000397
Sequence length 223
Comment MED8 SGDID:S000000397, Chr II from 609748-609077, reverse complement, Verified ORF, "Subunit of the RNA polymerase II mediator complex; associates with core polymerase subunits to form the RNA polymerase II holoenzyme; essential for transcriptional regulation"
Sequence
MSQSTASLVPEGNQGSLQEDVSFDFNGVPGQALDAVRMRLAQLTHSLRRIRDEMSKAELP
QWYTLQSQLNVTLSQLVSVTSTLQHFQETLDSTVVYPLPKFPTTSHESLVTTLLRKKNIP
EVDEWMKYVRETSGVTTALLKDEEIEKLLQQDREITNWARTTFRNEYGKHDFKNEESLSE
EHASLLVRDSKPSKPFNVDDVLKFTFTGEKPIITGSTSTSSSN
Download sequence
Identical sequences G2W9J4 N1P9K0 P38304
YBR193C 4932.YBR193C YBR193C YBR193C YBR193C YBR193C YBR193C YBR193C 3j1o.J 3rj1.C 3rj1.J 3rj1.Q YBR193C YBR193C YBR193C Pf-sce:YBR193C YBR193C YBR193C

Jump to [ Top of page · Domain architecture · Domain assignment details ]