SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YBR208C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR208C
Domain Number 1 Region: 32-457
Classification Level Classification E-value
Superfamily Amidase signature (AS) enzymes 8.63e-106
Family Amidase signature (AS) enzymes 0.0000138
Further Details:      
 
Domain Number 2 Region: 714-983
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.33e-64
Family BC ATP-binding domain-like 0.00000791
Further Details:      
 
Domain Number 3 Region: 590-743
Classification Level Classification E-value
Superfamily PreATP-grasp domain 9.35e-48
Family BC N-terminal domain-like 0.0000719
Further Details:      
 
Domain Number 4 Region: 962-1073
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 3.4e-33
Family BC C-terminal domain-like 0.00054
Further Details:      
 
Domain Number 5 Region: 1261-1385
Classification Level Classification E-value
Superfamily Cyclophilin-like 7.96e-29
Family PH0987 C-terminal domain-like 0.012
Further Details:      
 
Domain Number 6 Region: 1553-1682
Classification Level Classification E-value
Superfamily Cyclophilin-like 2.01e-27
Family PH0987 C-terminal domain-like 0.0015
Further Details:      
 
Domain Number 7 Region: 1757-1832
Classification Level Classification E-value
Superfamily Single hybrid motif 1.16e-17
Family Biotinyl/lipoyl-carrier proteins and domains 0.0017
Further Details:      
 
Domain Number 8 Region: 1438-1530
Classification Level Classification E-value
Superfamily PH0987 N-terminal domain-like 0.0000000000000432
Family PH0987 N-terminal domain-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
nuclear envelope 1.691 25.14
spliceosomal complex 2.025 13.33
cilium 1.611 8.71
mitochondrial envelope 1.571 8.24
mitochondrial inner membrane 1.752 8.24
mitochondrial membrane part 1.917 8.24
plastid 1.598 6.92
chloroplast part 1.897 6.92
clathrin-coated vesicle 1.877 6.36
cytoplasmic vesicle part 1.738 6.25
Molecular Function IC (bits) H-Score
acid-amino acid ligase activity 1.645 79.39
isomerase activity 1.671 68.09
carbamoyl-phosphate synthase (glutamine-hydrolyzing) activity 2.066 61.03
monocarboxylic acid binding 1.996 51.67
lyase activity 1.476 42
cofactor binding 1.606 39.77
drug binding 2.138 31.55
peptide binding 1.773 24.68
protein complex binding 1.49 18.6
sulfur compound binding 1.462 16.62

Protein sequence

External link(s) Locus: YBR208C   Protein: S000000412
Sequence length 1835
Comment DUR1,2 SGDID:S000000412, Chr II from 642205-636698, reverse complement, Verified ORF, "Urea amidolyase, contains both urea carboxylase and allophanate hydrolase activities, degrades urea to CO2 and NH3; expression sensitive to nitrogen catabolite repression and induced by allophanate, an intermediate in allantoin degradation"
Sequence
MTVSSDTTAEISLGWSIQDWIDFHKSSSSQASLRLLESLLDSQNVAPVDNAWISLISKEN
LLHQFQILKSRENKETLPLYGVPIAVKDNIDVRGLPTTAACPSFAYEPSKDSKVVELLRN
AGAIIVGKTNLDQFATGLVGTRSPYGKTPCAFSKEHVSGGSSAGSASVVARGIVPIALGT
DTAGSGRVPAALNNLIGLKPTKGVFSCQGVVPACKSLDCVSIFALNLSDAERCFRIMCQP
DPDNDEYSRPYVSNPLKKFSSNVTIAIPKNIPWYGETKNPVLFSNAVENLSRTGANVIEI
DFEPLLELARCLYEGTWVAERYQAIQSFLDSKPPKESLDPTVISIIEGAKKYSAVDCFSF
EYKRQGILQKVRRLLESVDVLCVPTCPLNPTMQQVADEPVLVNSRQGTWTNFVNLADLAA
LAVPAGFRDDGLPNGITLIGKKFTDYALLELANRYFQNIFPNGSRTYGTFTSSSVKPAND
QLVGPDYDPSTSIKLAVVGAHLKGLPLHWQLEKVNATYLCTTKTSKAYQLFALPKNGPVL
KPGLRRVQDSNGSQIELEVYSVPKELFGAFISMVPEPLGIGSVELESGEWIKSFICEESG
YKAKGTVDITKYGGFRAYFEMLKKKESQKKKLFDTVLIANRGEIAVRIIKTLKKLGIRSV
AVYSDPDKYSQHVTDADVSVPLHGTTAAQTYLDMNKIIDAAKQTNAQAIIPGYGFLSENA
DFSDACTSAGITFVGPSGDIIRGLGLKHSARQIAQKAGVPLVPGSLLITSVEEAKKVAAE
LEYPVMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVE
VQLMGDGFGKAIALGERDCSLQRRNQKVIEETPAPNLPEKTRLALRKAAESLGSLLNYKC
AGTVEFIYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIAANDAPDFDSTKVE
VNGVSMEARLYAENPLKNFRPSPGLLVDVKFPDWARVDTWVKKGTNISPEYDPTLAKIIV
HGKDRDDAISKLNQALEETKVYGCITNIDYLKSIITSDFFAKAKVSTNILNSYQYEPTAI
EITLPGAHTSIQDYPGRVGYWRIGVPPSGPMDAYSFRLANRIVGNDYRTPAIEVTLTGPS
IVFHCETVIAITGGTALCTLDGQEIPQHKPVEVKRGSTLSIGKLTSGCRAYLGIRGGIDV
PKYLGSYSTFTLGNVGGYNGRVLKLGDVLFLPSNEENKSVECLPQNIPQSLIPQISETKE
WRIGVTCGPHGSPDFFKPESIEEFFSEKWKVHYNSNRFGVRLIGPKPKWARSNGGEGGMH
PSNTHDYVYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVPEAELWKVGQVKPGDSIQFV
PLSYESSRSLKESQDVAIKSLDGTKLRRLDSVSILPSFETPILAQMEKVNELSPKVVYRQ
AGDRYVLVEYGDNEMNFNISYRIECLISLVKKNKTIGIVEMSQGVRSVLIEFDGYKVTQK
ELLKVLVAYETEIQFDENWKITSNIIRLPMAFEDSKTLACVQRYQETIRSSAPWLPNNVD
FIANVNGISRNEVYDMLYSARFMVLGLGDVFLGSPCAVPLDPRHRFLGSKYNPSRTYTER
GAVGIGGMYMCIYAANSPGGYQLVGRTIPIWDKLCLAASSEVPWLMNPFDQVEFYPVSEE
DLDKMTEDCDNGVYKVNIEKSVFDHQEYLRWINANKDSITAFQEGQLGERAEEFAKLIQN
ANSELKESVTVKPDEEEDFPEGAEIVYSEYSGRFWKSIASVGDVIEAGQGLLIIEAMKAE
MIISAPKSGKIIKICHGNGDMVDSGDIVAVIETLA
Download sequence
Identical sequences C7GKH0 P32528
YBR208C YBR208C 4932.YBR208C YBR208C YBR208C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]