SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR208C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR208C
Domain Number 1 Region: 32-457
Classification Level Classification E-value
Superfamily Amidase signature (AS) enzymes 8.63e-106
Family Amidase signature (AS) enzymes 1.38e-05
Further Details:      
 
Domain Number 2 Region: 714-983
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.33e-64
Family BC ATP-binding domain-like 7.91e-06
Further Details:      
 
Domain Number 3 Region: 590-743
Classification Level Classification E-value
Superfamily PreATP-grasp domain 9.35e-48
Family BC N-terminal domain-like 7.19e-05
Further Details:      
 
Domain Number 4 Region: 962-1073
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 3.4e-33
Family BC C-terminal domain-like 0.00054
Further Details:      
 
Domain Number 5 Region: 1261-1385
Classification Level Classification E-value
Superfamily Cyclophilin-like 7.96e-29
Family PH0987 C-terminal domain-like 0.012
Further Details:      
 
Domain Number 6 Region: 1553-1682
Classification Level Classification E-value
Superfamily Cyclophilin-like 2.01e-27
Family PH0987 C-terminal domain-like 0.0015
Further Details:      
 
Domain Number 7 Region: 1757-1832
Classification Level Classification E-value
Superfamily Single hybrid motif 1.16e-17
Family Biotinyl/lipoyl-carrier proteins and domains 0.0017
Further Details:      
 
Domain Number 8 Region: 1438-1530
Classification Level Classification E-value
Superfamily PH0987 N-terminal domain-like 4.32e-14
Family PH0987 N-terminal domain-like 0.0029
Further Details:      
 

Protein sequence

External link(s) Locus: YBR208C   Protein: S000000412
Sequence length 1835
Comment DUR1,2 SGDID:S000000412, Chr II from 642205-636698, reverse complement, Verified ORF, "Urea amidolyase, contains both urea carboxylase and allophanate hydrolase activities, degrades urea to CO2 and NH3; expression sensitive to nitrogen catabolite repression and induced by allophanate, an intermediate in allantoin degradation"
Sequence
MTVSSDTTAEISLGWSIQDWIDFHKSSSSQASLRLLESLLDSQNVAPVDNAWISLISKEN
LLHQFQILKSRENKETLPLYGVPIAVKDNIDVRGLPTTAACPSFAYEPSKDSKVVELLRN
AGAIIVGKTNLDQFATGLVGTRSPYGKTPCAFSKEHVSGGSSAGSASVVARGIVPIALGT
DTAGSGRVPAALNNLIGLKPTKGVFSCQGVVPACKSLDCVSIFALNLSDAERCFRIMCQP
DPDNDEYSRPYVSNPLKKFSSNVTIAIPKNIPWYGETKNPVLFSNAVENLSRTGANVIEI
DFEPLLELARCLYEGTWVAERYQAIQSFLDSKPPKESLDPTVISIIEGAKKYSAVDCFSF
EYKRQGILQKVRRLLESVDVLCVPTCPLNPTMQQVADEPVLVNSRQGTWTNFVNLADLAA
LAVPAGFRDDGLPNGITLIGKKFTDYALLELANRYFQNIFPNGSRTYGTFTSSSVKPAND
QLVGPDYDPSTSIKLAVVGAHLKGLPLHWQLEKVNATYLCTTKTSKAYQLFALPKNGPVL
KPGLRRVQDSNGSQIELEVYSVPKELFGAFISMVPEPLGIGSVELESGEWIKSFICEESG
YKAKGTVDITKYGGFRAYFEMLKKKESQKKKLFDTVLIANRGEIAVRIIKTLKKLGIRSV
AVYSDPDKYSQHVTDADVSVPLHGTTAAQTYLDMNKIIDAAKQTNAQAIIPGYGFLSENA
DFSDACTSAGITFVGPSGDIIRGLGLKHSARQIAQKAGVPLVPGSLLITSVEEAKKVAAE
LEYPVMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVE
VQLMGDGFGKAIALGERDCSLQRRNQKVIEETPAPNLPEKTRLALRKAAESLGSLLNYKC
AGTVEFIYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIAANDAPDFDSTKVE
VNGVSMEARLYAENPLKNFRPSPGLLVDVKFPDWARVDTWVKKGTNISPEYDPTLAKIIV
HGKDRDDAISKLNQALEETKVYGCITNIDYLKSIITSDFFAKAKVSTNILNSYQYEPTAI
EITLPGAHTSIQDYPGRVGYWRIGVPPSGPMDAYSFRLANRIVGNDYRTPAIEVTLTGPS
IVFHCETVIAITGGTALCTLDGQEIPQHKPVEVKRGSTLSIGKLTSGCRAYLGIRGGIDV
PKYLGSYSTFTLGNVGGYNGRVLKLGDVLFLPSNEENKSVECLPQNIPQSLIPQISETKE
WRIGVTCGPHGSPDFFKPESIEEFFSEKWKVHYNSNRFGVRLIGPKPKWARSNGGEGGMH
PSNTHDYVYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVPEAELWKVGQVKPGDSIQFV
PLSYESSRSLKESQDVAIKSLDGTKLRRLDSVSILPSFETPILAQMEKVNELSPKVVYRQ
AGDRYVLVEYGDNEMNFNISYRIECLISLVKKNKTIGIVEMSQGVRSVLIEFDGYKVTQK
ELLKVLVAYETEIQFDENWKITSNIIRLPMAFEDSKTLACVQRYQETIRSSAPWLPNNVD
FIANVNGISRNEVYDMLYSARFMVLGLGDVFLGSPCAVPLDPRHRFLGSKYNPSRTYTER
GAVGIGGMYMCIYAANSPGGYQLVGRTIPIWDKLCLAASSEVPWLMNPFDQVEFYPVSEE
DLDKMTEDCDNGVYKVNIEKSVFDHQEYLRWINANKDSITAFQEGQLGERAEEFAKLIQN
ANSELKESVTVKPDEEEDFPEGAEIVYSEYSGRFWKSIASVGDVIEAGQGLLIIEAMKAE
MIISAPKSGKIIKICHGNGDMVDSGDIVAVIETLA
Download sequence
Identical sequences C7GKH0 P32528
YBR208C 4932.YBR208C YBR208C YBR208C YBR208C

Jump to [ Top of page · Domain architecture · Domain assignment details ]