SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR208C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR208C
Domain Number 1 Region: 32-457
Classification Level Classification E-value
Superfamily Amidase signature (AS) enzymes 8.63e-106
Family Amidase signature (AS) enzymes 1.38e-05
Further Details:      
 
Domain Number 2 Region: 714-983
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.33e-64
Family BC ATP-binding domain-like 7.91e-06
Further Details:      
 
Domain Number 3 Region: 590-743
Classification Level Classification E-value
Superfamily PreATP-grasp domain 9.35e-48
Family BC N-terminal domain-like 7.19e-05
Further Details:      
 
Domain Number 4 Region: 962-1073
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 3.4e-33
Family BC C-terminal domain-like 0.00054
Further Details:      
 
Domain Number 5 Region: 1261-1385
Classification Level Classification E-value
Superfamily Cyclophilin-like 7.96e-29
Family PH0987 C-terminal domain-like 0.012
Further Details:      
 
Domain Number 6 Region: 1553-1682
Classification Level Classification E-value
Superfamily Cyclophilin-like 2.01e-27
Family PH0987 C-terminal domain-like 0.0015
Further Details:      
 
Domain Number 7 Region: 1757-1832
Classification Level Classification E-value
Superfamily Single hybrid motif 1.16e-17
Family Biotinyl/lipoyl-carrier proteins and domains 0.0017
Further Details:      
 
Domain Number 8 Region: 1438-1530
Classification Level Classification E-value
Superfamily PH0987 N-terminal domain-like 4.32e-14
Family PH0987 N-terminal domain-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
acid-amino acid ligase activity 1.646 79.46
isomerase activity 1.669 67.84
carbamoyl-phosphate synthase (glutamine-hydrolyzing) activity 2.067 61.08
monocarboxylic acid binding 1.997 51.72
lyase activity 1.477 42.03
cofactor binding 1.604 39.86
drug binding 2.13 31.31
peptide binding 1.774 24.13
protein complex binding 1.491 18.51
sulfur compound binding 1.463 16.58
Cellular Component IC (bits) H-Score
nuclear envelope 1.697 25.11
spliceosomal complex 2.017 13.32
cilium 1.61 8.37
mitochondrial envelope 1.57 8.23
mitochondrial inner membrane 1.751 8.23
mitochondrial membrane part 1.917 8.23
cytoplasmic vesicle part 1.737 8.17
cytoplasmic vesicle membrane 1.917 8.17
axon 1.502 7.4
clathrin-coated vesicle 1.876 7.04

Protein sequence

External link(s) Locus: YBR208C   Protein: S000000412
Sequence length 1835
Comment DUR1,2 SGDID:S000000412, Chr II from 642205-636698, reverse complement, Verified ORF, "Urea amidolyase, contains both urea carboxylase and allophanate hydrolase activities, degrades urea to CO2 and NH3; expression sensitive to nitrogen catabolite repression and induced by allophanate, an intermediate in allantoin degradation"
Sequence
MTVSSDTTAEISLGWSIQDWIDFHKSSSSQASLRLLESLLDSQNVAPVDNAWISLISKEN
LLHQFQILKSRENKETLPLYGVPIAVKDNIDVRGLPTTAACPSFAYEPSKDSKVVELLRN
AGAIIVGKTNLDQFATGLVGTRSPYGKTPCAFSKEHVSGGSSAGSASVVARGIVPIALGT
DTAGSGRVPAALNNLIGLKPTKGVFSCQGVVPACKSLDCVSIFALNLSDAERCFRIMCQP
DPDNDEYSRPYVSNPLKKFSSNVTIAIPKNIPWYGETKNPVLFSNAVENLSRTGANVIEI
DFEPLLELARCLYEGTWVAERYQAIQSFLDSKPPKESLDPTVISIIEGAKKYSAVDCFSF
EYKRQGILQKVRRLLESVDVLCVPTCPLNPTMQQVADEPVLVNSRQGTWTNFVNLADLAA
LAVPAGFRDDGLPNGITLIGKKFTDYALLELANRYFQNIFPNGSRTYGTFTSSSVKPAND
QLVGPDYDPSTSIKLAVVGAHLKGLPLHWQLEKVNATYLCTTKTSKAYQLFALPKNGPVL
KPGLRRVQDSNGSQIELEVYSVPKELFGAFISMVPEPLGIGSVELESGEWIKSFICEESG
YKAKGTVDITKYGGFRAYFEMLKKKESQKKKLFDTVLIANRGEIAVRIIKTLKKLGIRSV
AVYSDPDKYSQHVTDADVSVPLHGTTAAQTYLDMNKIIDAAKQTNAQAIIPGYGFLSENA
DFSDACTSAGITFVGPSGDIIRGLGLKHSARQIAQKAGVPLVPGSLLITSVEEAKKVAAE
LEYPVMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVE
VQLMGDGFGKAIALGERDCSLQRRNQKVIEETPAPNLPEKTRLALRKAAESLGSLLNYKC
AGTVEFIYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIAANDAPDFDSTKVE
VNGVSMEARLYAENPLKNFRPSPGLLVDVKFPDWARVDTWVKKGTNISPEYDPTLAKIIV
HGKDRDDAISKLNQALEETKVYGCITNIDYLKSIITSDFFAKAKVSTNILNSYQYEPTAI
EITLPGAHTSIQDYPGRVGYWRIGVPPSGPMDAYSFRLANRIVGNDYRTPAIEVTLTGPS
IVFHCETVIAITGGTALCTLDGQEIPQHKPVEVKRGSTLSIGKLTSGCRAYLGIRGGIDV
PKYLGSYSTFTLGNVGGYNGRVLKLGDVLFLPSNEENKSVECLPQNIPQSLIPQISETKE
WRIGVTCGPHGSPDFFKPESIEEFFSEKWKVHYNSNRFGVRLIGPKPKWARSNGGEGGMH
PSNTHDYVYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVPEAELWKVGQVKPGDSIQFV
PLSYESSRSLKESQDVAIKSLDGTKLRRLDSVSILPSFETPILAQMEKVNELSPKVVYRQ
AGDRYVLVEYGDNEMNFNISYRIECLISLVKKNKTIGIVEMSQGVRSVLIEFDGYKVTQK
ELLKVLVAYETEIQFDENWKITSNIIRLPMAFEDSKTLACVQRYQETIRSSAPWLPNNVD
FIANVNGISRNEVYDMLYSARFMVLGLGDVFLGSPCAVPLDPRHRFLGSKYNPSRTYTER
GAVGIGGMYMCIYAANSPGGYQLVGRTIPIWDKLCLAASSEVPWLMNPFDQVEFYPVSEE
DLDKMTEDCDNGVYKVNIEKSVFDHQEYLRWINANKDSITAFQEGQLGERAEEFAKLIQN
ANSELKESVTVKPDEEEDFPEGAEIVYSEYSGRFWKSIASVGDVIEAGQGLLIIEAMKAE
MIISAPKSGKIIKICHGNGDMVDSGDIVAVIETLA
Download sequence
Identical sequences C7GKH0 P32528
YBR208C 4932.YBR208C YBR208C YBR208C YBR208C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]