SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR238C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YBR238C
Domain Number - Region: 317-406
Classification Level Classification E-value
Superfamily HCP-like 0.0366
Family HCP-like 0.031
Further Details:      
 

Protein sequence

External link(s) Locus: YBR238C   Protein: S000000442
Sequence length 731
Comment YBR238C SGDID:S000000442, Chr II from 697297-695102, reverse complement, Verified ORF, "Mitochondrial membrane protein with similarity to Rmd9p; not required for respiratory growth but causes a synthetic respiratory defect in combination with rmd9 mutations; transcriptionally up-regulated by TOR; deletion increases life span"
Sequence
MIRLAQQTQVLKGKPPNQFVPHPTKNSLTHPMKFNGTIAMEHHEHNYAIPYTPATFNNPA
LATYQVSPANHFVPHFGGNIGANNNNHLAQNNSNNSNNHHNNNRNHHHNNNRNHHQNNHN
HSKYNNSNQGNSISPDSPWFHKVCAFEDCVSQTLYMSQTPRRQNMKHHSEHPNSNANPLF
WDSIGRAMGLYHDLLTTPELNSDRVSKLVHLLHNGLRANRNQLTRMNKKPDYDSQSFHKE
MTNYLCKSLREISEDVLNGKVELNEYGAMHLITAFKELLLFEEAVDIWKAAINGQNTYTS
NIFLNPRVVGVILPILYDNGVSYPEIQALYEKSSSMINYFHPNLSVGMIRASLSASENDM
ALKLFQKLCQESTEMKYGYLIETHLSFIGECKDLNVAQTFFDKALNDEMPYKIDLQVSYV
KSFLRNIWSQTRDFNHIYQIWYKSSLHYGRNVNHGISSSLNDTFFDIFFENYAVDKMQGF
QTLQNIIQTYNNIKHIDEPFFNIILAKCTVWHDRSILEYIDKSYEAYHIPKTIVAYRILL
KSMGSVDDASNAEILQRWMDLIRKSDEIGQRFIANADWAALRDATVTWTQNDRDSKKSNM
NSTQISRTATPSPSLTPMDTPAPEHLFNNPQNPMDFYSHPALQAATASGAFDEFAAEAAS
SSIPVDGRMVLYLKIVKRYSPYCRDSRQLARLTTGTAVKYSVLQEVLNQFQTLIVNDIPI
PELHNLKPTCV
Download sequence
Identical sequences A6ZLH7 C7GMR5 G2W9P1 P38330
YBR238C 4932.YBR238C YBR238C YBR238C YBR238C YBR238C tr|A6ZLH7|A6ZLH7_YEAS7

Jump to [ Top of page · Domain architecture · Domain assignment details ]