SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR238C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YBR238C
Domain Number - Region: 317-406
Classification Level Classification E-value
Superfamily HCP-like 0.0366
Family HCP-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YBR238C   Protein: S000000442
Sequence length 731
Comment YBR238C SGDID:S000000442, Chr II from 697297-695102, reverse complement, Verified ORF, "Mitochondrial membrane protein with similarity to Rmd9p; not required for respiratory growth but causes a synthetic respiratory defect in combination with rmd9 mutations; transcriptionally up-regulated by TOR; deletion increases life span"
Sequence
MIRLAQQTQVLKGKPPNQFVPHPTKNSLTHPMKFNGTIAMEHHEHNYAIPYTPATFNNPA
LATYQVSPANHFVPHFGGNIGANNNNHLAQNNSNNSNNHHNNNRNHHHNNNRNHHQNNHN
HSKYNNSNQGNSISPDSPWFHKVCAFEDCVSQTLYMSQTPRRQNMKHHSEHPNSNANPLF
WDSIGRAMGLYHDLLTTPELNSDRVSKLVHLLHNGLRANRNQLTRMNKKPDYDSQSFHKE
MTNYLCKSLREISEDVLNGKVELNEYGAMHLITAFKELLLFEEAVDIWKAAINGQNTYTS
NIFLNPRVVGVILPILYDNGVSYPEIQALYEKSSSMINYFHPNLSVGMIRASLSASENDM
ALKLFQKLCQESTEMKYGYLIETHLSFIGECKDLNVAQTFFDKALNDEMPYKIDLQVSYV
KSFLRNIWSQTRDFNHIYQIWYKSSLHYGRNVNHGISSSLNDTFFDIFFENYAVDKMQGF
QTLQNIIQTYNNIKHIDEPFFNIILAKCTVWHDRSILEYIDKSYEAYHIPKTIVAYRILL
KSMGSVDDASNAEILQRWMDLIRKSDEIGQRFIANADWAALRDATVTWTQNDRDSKKSNM
NSTQISRTATPSPSLTPMDTPAPEHLFNNPQNPMDFYSHPALQAATASGAFDEFAAEAAS
SSIPVDGRMVLYLKIVKRYSPYCRDSRQLARLTTGTAVKYSVLQEVLNQFQTLIVNDIPI
PELHNLKPTCV
Download sequence
Identical sequences A6ZLH7 C7GMR5 G2W9P1 P38330
tr|A6ZLH7|A6ZLH7_YEAS7 YBR238C YBR238C YBR238C 4932.YBR238C YBR238C YBR238C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]