SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR243C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YBR243C   Protein: S000000447
Sequence length 448
Comment ALG7 SGDID:S000000447, Chr II from 706788-705442, reverse complement, Verified ORF, "UDP-N-acetyl-glucosamine-1-P transferase, transfers Glc-Nac-P from UDP-GlcNac to Dol-P in the ER in the first step of the dolichol pathway of protein asparagine-linked glycosylation; inhibited by tunicamycin"
Sequence
MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSFIKIGLFGKDL
SKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITTSGGGHRDVSVVEDNGMNSNI
FPHDKLSEYLSAILCLESTVLLGIADDLFDLRWRHKFFLPAIAAIPLLMVYYVDFGVTHV
LIPGFMERWLKKTSVDLGLWYYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLN
DLLYFSMGPLATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV
GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDGLMYPSRANLKEEP
PKSIFKPILKLLYCLHLIDLEFDENNEIISTSNMTLINLTLVWFGPMREDKLCNTILKLQ
FCIGILALLGRHAIGAIIFGHDNLWTVR
Download sequence
Identical sequences A6ZLI2 B3LMR9 B5VEJ3 C7GMY8 D3UEZ1 E7LRQ2 E7Q198 E7QBQ8 G2W9P6 H0GCT9 P07286
YBR243C YBR243C YBR243C YBR243C YBR243C YBR243C 2158S YBR243C YBR243C YBR243C 4932.YBR243C YBR243C SCRT_02727 YBR243C YBR243C tr|A6ZLI2|A6ZLI2_YEAS7 YBR243C YBR243C YBR243C YBR243C YBR243C YBR243C YBR243C

Jump to [ Top of page · Domain architecture · Domain assignment details ]