SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YBR256C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR256C
Domain Number 1 Region: 100-212
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 2.89e-27
Family Riboflavin synthase 0.0000513
Further Details:      
 
Domain Number 2 Region: 1-94
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 4.08e-23
Family Riboflavin synthase 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
integral to plasma membrane 1.469 58.56

Protein sequence

External link(s) Locus: YBR256C   Protein: S000000460
Sequence length 238
Comment RIB5 SGDID:S000000460, Chr II from 728097-727381, reverse complement, Verified ORF, "Riboflavin synthase; catalyzes the last step of the riboflavin biosynthesis pathway"
Sequence
MFTGIVECMGTVLENNPYDDSESGGQGVSITIGNAGSILTDCHVGDSIAVNGVCLTVTEF
NNDSFKVGISPETIKRSNVASWIQGTQVNLERAVSQDVRFGGHYVQGHVDTVANIVSRRP
EGNSIIFGFQLRDQEYFKYIVEKGFICIDGTSLTIIKVDPLSQGGAFYISMIKHTQDNVI
MPLKKIGDEVNIEVDLTGKIIEKQILLTLENQISKKDSTLNTMISNIIEEKVRNYLNK
Download sequence
Identical sequences B3LMQ5 D3UF04 E7K9K8 N1P9M6 P38145 W7RIB6
4932.YBR256C YBR256C YBR256C SCRT_02713 YBR256C YBR256C YBR256C YBR256C YBR256c YT358 YBR256C YBR256C YBR256C YBR256C YBR256C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]