SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR256C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR256C
Domain Number 1 Region: 100-212
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 2.89e-27
Family Riboflavin synthase 5.13e-05
Further Details:      
 
Domain Number 2 Region: 1-94
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 4.08e-23
Family Riboflavin synthase 0.00017
Further Details:      
 

Protein sequence

External link(s) Locus: YBR256C   Protein: S000000460
Sequence length 238
Comment RIB5 SGDID:S000000460, Chr II from 728097-727381, reverse complement, Verified ORF, "Riboflavin synthase; catalyzes the last step of the riboflavin biosynthesis pathway"
Sequence
MFTGIVECMGTVLENNPYDDSESGGQGVSITIGNAGSILTDCHVGDSIAVNGVCLTVTEF
NNDSFKVGISPETIKRSNVASWIQGTQVNLERAVSQDVRFGGHYVQGHVDTVANIVSRRP
EGNSIIFGFQLRDQEYFKYIVEKGFICIDGTSLTIIKVDPLSQGGAFYISMIKHTQDNVI
MPLKKIGDEVNIEVDLTGKIIEKQILLTLENQISKKDSTLNTMISNIIEEKVRNYLNK
Download sequence
Identical sequences B3LMQ5 D3UF04 E7K9K8 P38145
YBR256C YBR256C 4932.YBR256C YBR256C YBR256C YBR256C SCRT_02713 YBR256C YBR256C YBR256C YBR256C YBR256c YT358 YBR256C YBR256C

Jump to [ Top of page · Domain architecture · Domain assignment details ]