SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR268W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YBR268W   Protein: S000000472
Sequence length 105
Comment MRPL37 SGDID:S000000472, Chr II from 741294-741611, Verified ORF, "Mitochondrial ribosomal protein of the large subunit"
Sequence
MLARSLGYRLISTSRILYNKPTVKSVVSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLW
SVLDSDHVVEHAAEDPEGQALLKRRKNIRKANRQRIKQNNFLSQL
Download sequence
Identical sequences C7GMW3 D3UF16 E7K9L4 E7LRR8 E7QBS8 H0GCW1 P36532
YBR268W YBR268W YBR268W YBR268W YBR268W YBR268W YTYst140 YBR268W YBR268W 4932.YBR268W YBR268W YBR268W YBR268W YBR268W YBR268W

Jump to [ Top of page · Domain architecture · Domain assignment details ]