SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR268W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YBR268W   Protein: S000000472
Sequence length 105
Comment MRPL37 SGDID:S000000472, Chr II from 741294-741611, Verified ORF, "Mitochondrial ribosomal protein of the large subunit"
Sequence
MLARSLGYRLISTSRILYNKPTVKSVVSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLW
SVLDSDHVVEHAAEDPEGQALLKRRKNIRKANRQRIKQNNFLSQL
Download sequence
Identical sequences C7GMW3 D3UF16 E7K9L4 E7LRR8 E7QBS8 H0GCW1 N1P8M3 P36532 W7Q8A1 W7RIC3
YTYst140 YBR268W YBR268W YBR268W YBR268W YBR268W YBR268W YBR268W 4932.YBR268W YBR268W YBR268W YBR268W YBR268W YBR268W YBR268W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]