SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YBR278W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR278W
Domain Number 1 Region: 12-91
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000184
Family TBP-associated factors, TAFs 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
protein-DNA complex subunit organization 2.089 45.31
chromatin assembly or disassembly 2.241 44.55
chromatin organization 1.589 28.34
chromosome organization 1.49 22.01
RNA biosynthetic process 1.494 19.09
protein acylation 2.042 14.57
response to bacterium 1.569 11.28
DNA replication 1.976 11.13
response to lipid 1.512 9.92
response to acid chemical 1.744 9.92

Protein sequence

External link(s) Locus: YBR278W   Protein: S000000482
Sequence length 201
Comment DPB3 SGDID:S000000482, Chr II from 760290-760895, Verified ORF, "Third-largest subunit of DNA polymerase II (DNA polymerase epsilon), required to maintain fidelity of chromosomal replication and also for inheritance of telomeric silencing; mRNA abundance peaks at the G1/S boundary of the cell cycle"
Sequence
MSNLVKEKAPVFPISKVKKIAKCDPEYVITSNVAISATAFAAELFVQNLVEESLVLAQLN
SKGKTSLRLSLNSIEECVEKRDNFRFLEDAIKQLKKNSALDKKRELNMQPGRSDQEVVIE
EPELHEDDGVEEEEEEDEVSEEEEPVHNEELLDDSKDQQNDKSTRSVASLLSRFQYKSAL
DVGEHSDSSDIEVDHTKSTDP
Download sequence
Identical sequences A6ZLL6 B5VEM3 C7GMV4 D3UF25 E7K9M1 E7KKP0 E7LRS2 E7NF68 E7QBT4 G2W9T1 H0GCW9 N1P8N3 P27344 W7PLN1 W7R5T6
YBR278W YBR278W YBR278W YBR278W YBR278W YBR278W YBR278W YBR278W YBR278W tr|A6ZLL6|A6ZLL6_YEAS7 YBR278W YBR278W YBR278W YBR278W YBR278W YBR278W YBR278W YBR278W YBR278W 4932.YBR278W YBR278W YBR278W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]