SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR278W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR278W
Domain Number 1 Region: 12-91
Classification Level Classification E-value
Superfamily Histone-fold 1.84e-12
Family TBP-associated factors, TAFs 0.0074
Further Details:      
 

Protein sequence

External link(s) Locus: YBR278W   Protein: S000000482
Sequence length 201
Comment DPB3 SGDID:S000000482, Chr II from 760290-760895, Verified ORF, "Third-largest subunit of DNA polymerase II (DNA polymerase epsilon), required to maintain fidelity of chromosomal replication and also for inheritance of telomeric silencing; mRNA abundance peaks at the G1/S boundary of the cell cycle"
Sequence
MSNLVKEKAPVFPISKVKKIAKCDPEYVITSNVAISATAFAAELFVQNLVEESLVLAQLN
SKGKTSLRLSLNSIEECVEKRDNFRFLEDAIKQLKKNSALDKKRELNMQPGRSDQEVVIE
EPELHEDDGVEEEEEEDEVSEEEEPVHNEELLDDSKDQQNDKSTRSVASLLSRFQYKSAL
DVGEHSDSSDIEVDHTKSTDP
Download sequence
Identical sequences A6ZLL6 B5VEM3 C7GMV4 D3UF25 E7K9M1 E7KKP0 E7LRS2 E7NF68 E7QBT4 G2W9T1 H0GCW9 N1P8N3 P27344 W7PLN1 W7R5T6
YBR278W YBR278W YBR278W YBR278W YBR278W YBR278W YBR278W YBR278W YBR278W YBR278W YBR278W 4932.YBR278W YBR278W YBR278W YBR278W tr|A6ZLL6|A6ZLL6_YEAS7 YBR278W YBR278W YBR278W YBR278W YBR278W YBR278W

Jump to [ Top of page · Domain architecture · Domain assignment details ]