SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR279W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YBR279W   Protein: S000000483
Sequence length 445
Comment PAF1 SGDID:S000000483, Chr II from 761253-762590, Verified ORF, "RNAP II-associated protein; defines large complex biochemically and functionally distinct from the Srb-Mediator form of Pol II holoenzyme; required for full expression of a subset of cell cycle-regulated genes; homolog of human PD2/hPAF1"
Sequence
MSKKQEYIAPIKYQNSLPVPQLPPKLLVYPESPETNADSSQLINSLYIKTNVTNLIQQDE
DLGMPVDLMKFPGLLNKLDSKLLYGFDNVKLDKDDRILLRDPRIDRLTKTDISKVTFLRR
TEYVSNTIAAHDNTSLKRKRRLDDGDSDDENLDVNHIISRVEGTFNKTDKWQHPVKKGVK
MVKKWDLLPDTASMDQVYFILKFMGSASLDTKEKKSLNTGIFRPVELEEDEWISMYATDH
KDSAILENELEKGMDEMDDDSHEGKIYKFKRIRDYDMKQVAEKPMTELAIRLNDKDGIAY
YKPLRSKIELRRRRVNDIIKPLVKEHDIDQLNVTLRNPSTKEANIRDKLRMKFDPINFAT
VDEEDDEDEEQPEDVKKESEGDSKTEGSEQEGENEKDEEIKQEKENEQDEENKQDENRAA
DTPETSDAVHTEQKPEEEKETLQEE
Download sequence
Identical sequences A6ZLL7 B3LMN4 B5VEM4 C7GMV3 E7K9M2 E7NF69 N1P785 P38351 W7REV1
YBR279W YBR279W YBR279W YBR279W YBR279W YBR279W YBR279W YBR279W YBR279W YBR279W 4932.YBR279W YBR279W SCRT_02692 YBR279W tr|A6ZLL7|A6ZLL7_YEAS7 YBR279W

Jump to [ Top of page · Domain architecture · Domain assignment details ]