SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR279W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YBR279W   Protein: S000000483
Sequence length 445
Comment PAF1 SGDID:S000000483, Chr II from 761253-762590, Verified ORF, "RNAP II-associated protein; defines large complex biochemically and functionally distinct from the Srb-Mediator form of Pol II holoenzyme; required for full expression of a subset of cell cycle-regulated genes; homolog of human PD2/hPAF1"
Sequence
MSKKQEYIAPIKYQNSLPVPQLPPKLLVYPESPETNADSSQLINSLYIKTNVTNLIQQDE
DLGMPVDLMKFPGLLNKLDSKLLYGFDNVKLDKDDRILLRDPRIDRLTKTDISKVTFLRR
TEYVSNTIAAHDNTSLKRKRRLDDGDSDDENLDVNHIISRVEGTFNKTDKWQHPVKKGVK
MVKKWDLLPDTASMDQVYFILKFMGSASLDTKEKKSLNTGIFRPVELEEDEWISMYATDH
KDSAILENELEKGMDEMDDDSHEGKIYKFKRIRDYDMKQVAEKPMTELAIRLNDKDGIAY
YKPLRSKIELRRRRVNDIIKPLVKEHDIDQLNVTLRNPSTKEANIRDKLRMKFDPINFAT
VDEEDDEDEEQPEDVKKESEGDSKTEGSEQEGENEKDEEIKQEKENEQDEENKQDENRAA
DTPETSDAVHTEQKPEEEKETLQEE
Download sequence
Identical sequences A6ZLL7 B3LMN4 B5VEM4 C7GMV3 E7K9M2 E7NF69 N1P785 P38351 W7REV1
YBR279W YBR279W YBR279W YBR279W YBR279W YBR279W YBR279W YBR279W YBR279W YBR279W 4932.YBR279W YBR279W SCRT_02692 YBR279W tr|A6ZLL7|A6ZLL7_YEAS7 YBR279W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]