SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR292C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YBR292C   Protein: S000000496
Sequence length 123
Comment YBR292C SGDID:S000000496, Chr II from 785069-784698, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; YBR292C is not an essential gene"
Sequence
MKFPADYHYTSPFRSCKYSNILHFISLLLIFSRVGLPNYIFIFLINKAANKEHRVETLLS
GNSANACKLFNILKSFQHLFFFFQICTIFSISIKLVLLKSQEYGRIPAEFSIIRSEKKKK
EEQ
Download sequence
Identical sequences D3UF39 P38357
YBR292C 4932.YBR292C YBR292C YBR292C YBR292C YBR292C YBR292C YBR292C

Jump to [ Top of page · Domain architecture · Domain assignment details ]