SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YBR292C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YBR292C   Protein: S000000496
Sequence length 123
Comment YBR292C SGDID:S000000496, Chr II from 785069-784698, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; YBR292C is not an essential gene"
Sequence
MKFPADYHYTSPFRSCKYSNILHFISLLLIFSRVGLPNYIFIFLINKAANKEHRVETLLS
GNSANACKLFNILKSFQHLFFFFQICTIFSISIKLVLLKSQEYGRIPAEFSIIRSEKKKK
EEQ
Download sequence
Identical sequences D3UF39 P38357
YBR292C YBR292C YBR292C YBR292C 4932.YBR292C YBR292C YBR292C YBR292C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]