SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR300C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YBR300C   Protein: S000000504
Sequence length 165
Comment YBR300C SGDID:S000000504, Chr II from 809091-808594, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps the verified gene YBR301W; YBR300C is not an essential gene"
Sequence
MAATPAAIEVSLTIVFVLFFSADVSLTRNSEMKAHTSKMDSYSSSIYMNVLPTSLAQTSY
HLAPISHLKCLSVQFSSHIHYSYYYGASVLERCVFHRSRIRGARFIVPIPFIAFPRHKNV
FSQCTYFRRIPLGCLQRCSCSFWPRKSQNQICFEPSLRGHLIFVL
Download sequence
Identical sequences C8Z9I4 P38362
YBR300C 4932.YBR300C YBR300C YBR300C YBR300C YT273 YBR300C YGR293C

Jump to [ Top of page · Domain architecture · Domain assignment details ]