SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR300C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YBR300C   Protein: S000000504
Sequence length 165
Comment YBR300C SGDID:S000000504, Chr II from 809091-808594, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps the verified gene YBR301W; YBR300C is not an essential gene"
Sequence
MAATPAAIEVSLTIVFVLFFSADVSLTRNSEMKAHTSKMDSYSSSIYMNVLPTSLAQTSY
HLAPISHLKCLSVQFSSHIHYSYYYGASVLERCVFHRSRIRGARFIVPIPFIAFPRHKNV
FSQCTYFRRIPLGCLQRCSCSFWPRKSQNQICFEPSLRGHLIFVL
Download sequence
Identical sequences C8Z9I4 P38362
YGR293C YBR300C YBR300C YBR300C YBR300C 4932.YBR300C YBR300C YT273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]