SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR302C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YBR302C   Protein: S000000506
Sequence length 379
Comment COS2 SGDID:S000000506, Chr II from 811473-810334, reverse complement, Verified ORF, "Protein of unknown function, member of the DUP380 subfamily of conserved, often subtelomerically-encoded proteins"
Sequence
MKENELKNEKSVDVLSFKQLESQKIVLPQDLFRSSFTWFCYEIYKSLAFRIWMLLWLPLS
VWWKLSNNCIYPLIVSLLVLFLGPIFVLVICGLSRKRSLSKQLIQFCKEITENTPSSDPH
DWEVVAANLNSYLYENNVWNTKYFFFNAMVCQEAFRTTLLEPFSLKKDKAAKVKSFKDSV
PYIEEALGVYFTEVEKQWKLFNTEKSWSPVGLEDAKLPKEAYRFKLTWFLKRISNIFMLI
PFLNFLCCIYVSRGMCLLLRTLYLGWILFMLVQGFQNIRVLIMSMEHKMQFLSTIINEQE
SGANGWDEIARKMNRYLFEKKAWKNEEFFFDGIDCEWFFNHFFYRVLSAKKSMWPLPLNV
ELWPYIKEAQLSRSEVLLV
Download sequence
Identical sequences P0CX12 P0CX13
YBR302C YML132W 4932.YBR302C 4932.YML132W YBR302C YML132W 4303S YBR302C YML132W

Jump to [ Top of page · Domain architecture · Domain assignment details ]