SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBR302C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YBR302C   Protein: S000000506
Sequence length 379
Comment COS2 SGDID:S000000506, Chr II from 811473-810334, reverse complement, Verified ORF, "Protein of unknown function, member of the DUP380 subfamily of conserved, often subtelomerically-encoded proteins"
Sequence
MKENELKNEKSVDVLSFKQLESQKIVLPQDLFRSSFTWFCYEIYKSLAFRIWMLLWLPLS
VWWKLSNNCIYPLIVSLLVLFLGPIFVLVICGLSRKRSLSKQLIQFCKEITENTPSSDPH
DWEVVAANLNSYLYENNVWNTKYFFFNAMVCQEAFRTTLLEPFSLKKDKAAKVKSFKDSV
PYIEEALGVYFTEVEKQWKLFNTEKSWSPVGLEDAKLPKEAYRFKLTWFLKRISNIFMLI
PFLNFLCCIYVSRGMCLLLRTLYLGWILFMLVQGFQNIRVLIMSMEHKMQFLSTIINEQE
SGANGWDEIARKMNRYLFEKKAWKNEEFFFDGIDCEWFFNHFFYRVLSAKKSMWPLPLNV
ELWPYIKEAQLSRSEVLLV
Download sequence
Identical sequences P0CX12 P0CX13
YBR302C YML132W YBR302C YML132W 4932.YBR302C 4932.YML132W 4303S YBR302C YML132W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]