SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YCL007C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YCL007C   Protein: S000000513
Sequence length 130
Comment YCL007C SGDID:S000000513, Chr III from 107366-106974, reverse complement, Dubious ORF, "Dubious ORF unlikely to encode a protein; overlaps verified ORF YCL005W-A; mutations in YCL007C were thought to confer sensitivity to calcofluor white, but this phenotype was later shown to be due to the defect in YCL005W-A"
Sequence
MELAKERNGPHQKHHGQCQNHCTSPNTVRQNKTNKLLLVKKKGKLVIWRHIVKKMLHIRL
VVLWSHYPEQHGHGTNHYEYTNNSIAKLDAQRVSRRRRKKREAERRDYDTYKLLITLCSL
LFVGPLFLKV
Download sequence
Identical sequences C8Z478 E7KKT9 E7LRX0 P25603
YCL007C YCL007C YCL007C YCL007C YCL007C YCL007C YCL007C YCL007C YT364 YCL007C YCL007C YCL007C YCL007C 4932.YCL007C YCL007C YCL007C YCL007C YCL007C YCL007C YCL007C YCL007C

Jump to [ Top of page · Domain architecture · Domain assignment details ]