SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YCL020W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YCL020W   Protein: S000000525
Sequence length 438
Comment YCL020W SGDID:S000000525, Chr III from 85102-86418, transposable_element_gene, "Retrotransposon TYA Gag gene co-transcribed with TYB Pol; translated as TYA or TYA-TYB polyprotein; Gag is a nucleocapsid protein that is the structural constituent of virus-like particles (VLPs); similar to retroviral Gag"
Sequence
MESQQLHQNPRSLHGSAYASVTSKEVPSNQDPLAVSASNLPEFDRDSTKVNSQQETTPGT
SAVPENHHHVSPQPASVPPPQNGQYQQHGMMTPNKAMASNWAHYQQPSMMTCSHYQTSPA
YYQPDPHYPLPQYIPPLSTSSPDPIDSQNQHSEVPQAETKVRNNVLPPHTLTSEENFSTW
VKFYIRFLKNSNLGDIIPNDQGEIKRQMTYEEHAYIYNTFQAFAPFHLLPTWVKQILEIN
YADILTVLCKSVSKMQTNNQELKDWIALANLEYDGSTSADTFEITVSTIIQRLKENNINV
SDRLACQLILKGLSGDFKYLRNQYRTKTNMKLSQLFAEIQLIYDENKIMNLNKPSQYKQH
SEYKNVSRTSPNTTNTKVTTRNYQRTNSSKPRAAKAHNIATSSKFSRVNNDHINESTVSS
QYLSDDNELSLRPATERI
Download sequence
Identical sequences D2XNR6 P25383
YCL020W 4932.YCL020W YCL020W YCL020W

Jump to [ Top of page · Domain architecture · Domain assignment details ]