SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YCL028W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YCL028W
Domain Number - Region: 5-37
Classification Level Classification E-value
Superfamily TPR-like 0.0342
Family Tetratricopeptide repeat (TPR) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YCL028W   Protein: S000000533
Sequence length 405
Comment RNQ1 SGDID:S000000533, Chr III from 70150-71367, Verified ORF, "[PIN(+)] prion, an infectious protein conformation that is generally an ordered protein aggregate"
Sequence
MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIAGYVMDNRSGG
SDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATVMTHSSNKGSSNRGFDVGTVM
SMLSGSGGGSQSMGASGLAALASQFFKSGNNSQGQGQGQGQGQGQGQGQGQGSFTALASL
ASSFMNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSYQNGNQN
SQGYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQSNQQQYNQQGQNNQQQ
YQQQGQNYQHQQQGQQQQQGHSSSFSALASMASSYLGNNSNSNSSYGGQQQANEYGRPQQ
NGQQQSNEYGRPQYGGNQNSNGQHESFNFSGNFSQQNNNGNQNRY
Download sequence
Identical sequences B3LU54 B5VET0 C8Z460 E7KA10 E7QC16 K4I0B6 N1P7S2 P25367 W7PKC5 W7R0R8
YCL028W YCL028W SCRT_05381 4932.YCL028W YCL028W YCL028W YCL028W YCL028W YCL028W YCL028W YCL028W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]