SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YCL028W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YCL028W
Domain Number - Region: 5-37
Classification Level Classification E-value
Superfamily TPR-like 0.0342
Family Tetratricopeptide repeat (TPR) 0.054
Further Details:      
 

Protein sequence

External link(s) Locus: YCL028W   Protein: S000000533
Sequence length 405
Comment RNQ1 SGDID:S000000533, Chr III from 70150-71367, Verified ORF, "[PIN(+)] prion, an infectious protein conformation that is generally an ordered protein aggregate"
Sequence
MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIAGYVMDNRSGG
SDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATVMTHSSNKGSSNRGFDVGTVM
SMLSGSGGGSQSMGASGLAALASQFFKSGNNSQGQGQGQGQGQGQGQGQGQGSFTALASL
ASSFMNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSYQNGNQN
SQGYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQSNQQQYNQQGQNNQQQ
YQQQGQNYQHQQQGQQQQQGHSSSFSALASMASSYLGNNSNSNSSYGGQQQANEYGRPQQ
NGQQQSNEYGRPQYGGNQNSNGQHESFNFSGNFSQQNNNGNQNRY
Download sequence
Identical sequences B3LU54 B5VET0 C8Z460 E7KA10 E7QC16 K4I0B6 N1P7S2 P25367 W7PKC5 W7R0R8
YCL028W 4932.YCL028W YCL028W YCL028W SCRT_05381 YCL028W YCL028W YCL028W YCL028W YCL028W YCL028W

Jump to [ Top of page · Domain architecture · Domain assignment details ]