SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YCL038C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YCL038C
Domain Number 1 Region: 28-54,90-517
Classification Level Classification E-value
Superfamily MFS general substrate transporter 7.06e-19
Family Glycerol-3-phosphate transporter 0.091
Further Details:      
 

Protein sequence

External link(s) Locus: YCL038C   Protein: S000000543
Sequence length 528
Comment ATG22 SGDID:S000000543, Chr III from 56527-54941, reverse complement, Verified ORF, "Vacuolar integral membrane protein required for efflux of amino acids during autophagic body breakdown in the vacuole; null mutation causes a gradual loss of viability during starvation"
Sequence
MSYGTINDMNESVTNYRIKKAQNNIKGWYAYSFSSEPFVVSAVSTYIPLLLQQFASINGV
KVHDHSIPCLSETGSDSDKCVLGLFNNRIFVDTSSFALYVFSLSVLFQTIIVISVSGIVD
LWGSVKFKGRILVWFGIVGALSTVAISKLNDTQIYSLAGLYIVANGCFGVINVVGNSLLP
IFVKDSLKCQSQGAYEPDKVDSLTTVISGRGASLGYSSALIVQIVSMFLVASKKGSKQDV
QVAVLFVGIWWFVWQLPMIWLIDDVTIPIRVDDSTLASARSPYPGEQDALGQLNWKNYLS
YGWVSLFESFKHARLLKDVMIFLIAWFIISDSITTINSTAVLFSKAELHMSTLNLIMISV
LTVVNAMLGAFMIPQFLATKFRWTSSQTLMYIIIWASFIPFYGILGFFFNAFGLKHKFEM
FLLAIWYGLSLGGLSAVSRSVFSLIVPPGKESTFFSMFSITDKGSSILGPFLVGLLTDKT
HNIRYSFYFFFLLLMLSLPVLNCLDVKRGRREAEELSQVLPESERRLD
Download sequence
Identical sequences P25568
YCL038C YCL038C 4932.YCL038C YCL038C 2399S YCL038C

Jump to [ Top of page · Domain architecture · Domain assignment details ]