SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YCL038C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YCL038C
Domain Number 1 Region: 28-54,90-517
Classification Level Classification E-value
Superfamily MFS general substrate transporter 7.06e-19
Family Glycerol-3-phosphate transporter 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
integral component of plasma membrane 1.462 17.19
vacuolar part 1.621 12.79
cell projection membrane 1.523 11.07
transport vesicle 2.075 9.9
clathrin-coated vesicle 2.107 9.9
cytoplasmic vesicle membrane 1.912 9.9
secretory granule 1.818 9.38
brush border 1.477 8.23
basolateral plasma membrane 1.896 7.88
sperm part 2.197 6.34

Protein sequence

External link(s) Locus: YCL038C   Protein: S000000543
Sequence length 528
Comment ATG22 SGDID:S000000543, Chr III from 56527-54941, reverse complement, Verified ORF, "Vacuolar integral membrane protein required for efflux of amino acids during autophagic body breakdown in the vacuole; null mutation causes a gradual loss of viability during starvation"
Sequence
MSYGTINDMNESVTNYRIKKAQNNIKGWYAYSFSSEPFVVSAVSTYIPLLLQQFASINGV
KVHDHSIPCLSETGSDSDKCVLGLFNNRIFVDTSSFALYVFSLSVLFQTIIVISVSGIVD
LWGSVKFKGRILVWFGIVGALSTVAISKLNDTQIYSLAGLYIVANGCFGVINVVGNSLLP
IFVKDSLKCQSQGAYEPDKVDSLTTVISGRGASLGYSSALIVQIVSMFLVASKKGSKQDV
QVAVLFVGIWWFVWQLPMIWLIDDVTIPIRVDDSTLASARSPYPGEQDALGQLNWKNYLS
YGWVSLFESFKHARLLKDVMIFLIAWFIISDSITTINSTAVLFSKAELHMSTLNLIMISV
LTVVNAMLGAFMIPQFLATKFRWTSSQTLMYIIIWASFIPFYGILGFFFNAFGLKHKFEM
FLLAIWYGLSLGGLSAVSRSVFSLIVPPGKESTFFSMFSITDKGSSILGPFLVGLLTDKT
HNIRYSFYFFFLLLMLSLPVLNCLDVKRGRREAEELSQVLPESERRLD
Download sequence
Identical sequences N1P7Z2 P25568
4932.YCL038C 2399S YCL038C YCL038C YCL038C YCL038C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]