SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YCL038C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YCL038C
Domain Number 1 Region: 28-54,90-517
Classification Level Classification E-value
Superfamily MFS general substrate transporter 7.06e-19
Family Glycerol-3-phosphate transporter 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
nucleobase-containing compound transport 2.039 39.45
ion transport 1.47 36.53
transmembrane transport 1.581 31.84
secretion 1.506 22.79
cellular chemical homeostasis 1.499 16.18
inorganic ion homeostasis 1.494 16.18
cation homeostasis 1.508 16.18
vacuole organization 2.183 16.18
response to organic cyclic compound 1.42 12.27
response to drug 1.512 12.02
Cellular Component IC (bits) H-Score
cytoplasmic vesicle part 1.417 14.48
vacuolar part 1.567 14.15
brush border membrane 1.487 11.03
clathrin-coated vesicle 1.989 10.1
presynapse 1.758 9.56
secretory vesicle 1.539 8.53
exocytic vesicle 2.03 7.81
lytic vacuole 1.553 7.12
intrinsic component of organelle membrane 2.016 6.26
synapse part 1.419 5.81

Protein sequence

External link(s) Locus: YCL038C   Protein: S000000543
Sequence length 528
Comment ATG22 SGDID:S000000543, Chr III from 56527-54941, reverse complement, Verified ORF, "Vacuolar integral membrane protein required for efflux of amino acids during autophagic body breakdown in the vacuole; null mutation causes a gradual loss of viability during starvation"
Sequence
MSYGTINDMNESVTNYRIKKAQNNIKGWYAYSFSSEPFVVSAVSTYIPLLLQQFASINGV
KVHDHSIPCLSETGSDSDKCVLGLFNNRIFVDTSSFALYVFSLSVLFQTIIVISVSGIVD
LWGSVKFKGRILVWFGIVGALSTVAISKLNDTQIYSLAGLYIVANGCFGVINVVGNSLLP
IFVKDSLKCQSQGAYEPDKVDSLTTVISGRGASLGYSSALIVQIVSMFLVASKKGSKQDV
QVAVLFVGIWWFVWQLPMIWLIDDVTIPIRVDDSTLASARSPYPGEQDALGQLNWKNYLS
YGWVSLFESFKHARLLKDVMIFLIAWFIISDSITTINSTAVLFSKAELHMSTLNLIMISV
LTVVNAMLGAFMIPQFLATKFRWTSSQTLMYIIIWASFIPFYGILGFFFNAFGLKHKFEM
FLLAIWYGLSLGGLSAVSRSVFSLIVPPGKESTFFSMFSITDKGSSILGPFLVGLLTDKT
HNIRYSFYFFFLLLMLSLPVLNCLDVKRGRREAEELSQVLPESERRLD
Download sequence
Identical sequences N1P7Z2 P25568
YCL038C YCL038C 2399S YCL038C YCL038C 4932.YCL038C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]