SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YCL040W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YCL040W
Domain Number 1 Region: 245-499
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 4.4e-73
Family Hexokinase 0.000036
Further Details:      
 
Domain Number 2 Region: 15-230
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 9.5e-64
Family Hexokinase 0.0000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
unfolded protein binding 2.088 17.96
protein domain specific binding 1.437 15.48
carbohydrate binding 1.864 13.66
isomerase activity 1.598 11.55
racemase and epimerase activity 2.232 11.55
nuclear hormone receptor binding 1.98 11.2
ATP binding 1.507 10.82
antigen binding 2.159 10.77
ATPase activity, coupled 1.512 7.41
DNA helicase activity 1.944 7.41
Cellular Component IC (bits) H-Score
cell-substrate junction 1.489 27.97
actin-based cell projection 1.624 23.46
chromosomal part 1.471 21.59
nuclear chromosome 1.727 21.59
nuclear chromatin 2.17 21.59
cell leading edge 1.401 18.62
SWI/SNF superfamily-type complex 2.079 14.51
actin cytoskeleton 1.39 13.82
transporter complex 1.657 13.55
cell body 1.528 13.14

Protein sequence

External link(s) Locus: YCL040W   Protein: S000000545
Sequence length 500
Comment GLK1 SGDID:S000000545, Chr III from 50838-52340, Verified ORF, "Glucokinase, catalyzes the phosphorylation of glucose at C6 in the first irreversible step of glucose metabolism; one of three glucose phosphorylating enzymes; expression regulated by non-fermentable carbon sources"
Sequence
MSFDDLHKATERAVIQAVDQICDDFEVTPEKLDELTAYFIEQMEKGLAPPKEGHTLASDK
GLPMIPAFVTGSPNGTERGVLLAADLGGTNFRICSVNLHGDHTFSMEQMKSKIPDDLLDD
ENVTSDDLFGFLARRTLAFMKKYHPDELAKGKDAKPMKLGFTFSYPVDQTSLNSGTLIRW
TKGFRIADTVGKDVVQLYQEQLSAQGMPMIKVVALTNDTVGTYLSHCYTSDNTDSMTSGE
ISEPVIGCIFGTGTNGCYMEEINKITKLPQELRDKLIKEGKTHMIINVEWGSFDNELKHL
PTTKYDVVIDQKLSTNPGFHLFEKRVSGMFLGEVLRNILVDLHSQGLLLQQYRSKEQLPR
HLTTPFQLSSEVLSHIEIDDSTGLRETELSLLQSLRLPTTPTERVQIQKLVRAISRRSAY
LAAVPLAAILIKTNALNKRYHGEVEIGCDGSVVEYYPGFRSMLRHALALSPLGAEGERKV
HLKIAKDGSGVGAALCALVA
Download sequence
Identical sequences C8Z449 N1P652 P17709
YCL040W YCL040W YCL040W YCL040W YCL042W YCL040W YCL040W 4932.YCL040W YCL040W YCL040W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]