SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YCL040W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YCL040W
Domain Number 1 Region: 245-499
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 4.4e-73
Family Hexokinase 3.6e-05
Further Details:      
 
Domain Number 2 Region: 15-230
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 9.5e-64
Family Hexokinase 1.73e-05
Further Details:      
 

Protein sequence

External link(s) Locus: YCL040W   Protein: S000000545
Sequence length 500
Comment GLK1 SGDID:S000000545, Chr III from 50838-52340, Verified ORF, "Glucokinase, catalyzes the phosphorylation of glucose at C6 in the first irreversible step of glucose metabolism; one of three glucose phosphorylating enzymes; expression regulated by non-fermentable carbon sources"
Sequence
MSFDDLHKATERAVIQAVDQICDDFEVTPEKLDELTAYFIEQMEKGLAPPKEGHTLASDK
GLPMIPAFVTGSPNGTERGVLLAADLGGTNFRICSVNLHGDHTFSMEQMKSKIPDDLLDD
ENVTSDDLFGFLARRTLAFMKKYHPDELAKGKDAKPMKLGFTFSYPVDQTSLNSGTLIRW
TKGFRIADTVGKDVVQLYQEQLSAQGMPMIKVVALTNDTVGTYLSHCYTSDNTDSMTSGE
ISEPVIGCIFGTGTNGCYMEEINKITKLPQELRDKLIKEGKTHMIINVEWGSFDNELKHL
PTTKYDVVIDQKLSTNPGFHLFEKRVSGMFLGEVLRNILVDLHSQGLLLQQYRSKEQLPR
HLTTPFQLSSEVLSHIEIDDSTGLRETELSLLQSLRLPTTPTERVQIQKLVRAISRRSAY
LAAVPLAAILIKTNALNKRYHGEVEIGCDGSVVEYYPGFRSMLRHALALSPLGAEGERKV
HLKIAKDGSGVGAALCALVA
Download sequence
Identical sequences C8Z449 N1P652 P17709
YCL040W YCL040W 4932.YCL040W YCL040W YCL040W YCL040W YCL040W YCL040W YCL040W YCL042W

Jump to [ Top of page · Domain architecture · Domain assignment details ]