SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YCL040W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YCL040W
Domain Number 1 Region: 245-499
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 4.4e-73
Family Hexokinase 3.6e-05
Further Details:      
 
Domain Number 2 Region: 15-230
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 9.5e-64
Family Hexokinase 1.73e-05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
nuclear chromosome 1.72 22.92
chromosomal part 1.477 22.92
chromatin 1.902 22.92
cilium 1.611 21.26
actin filament 2.168 18.13
SWI/SNF superfamily-type complex 2.178 16.21
cation channel complex 2.039 14.38
endoplasmic reticulum part 1.433 13.39
cytosol 1.307 10.29
microtubule cytoskeleton 1.334 8.24

Protein sequence

External link(s) Locus: YCL040W   Protein: S000000545
Sequence length 500
Comment GLK1 SGDID:S000000545, Chr III from 50838-52340, Verified ORF, "Glucokinase, catalyzes the phosphorylation of glucose at C6 in the first irreversible step of glucose metabolism; one of three glucose phosphorylating enzymes; expression regulated by non-fermentable carbon sources"
Sequence
MSFDDLHKATERAVIQAVDQICDDFEVTPEKLDELTAYFIEQMEKGLAPPKEGHTLASDK
GLPMIPAFVTGSPNGTERGVLLAADLGGTNFRICSVNLHGDHTFSMEQMKSKIPDDLLDD
ENVTSDDLFGFLARRTLAFMKKYHPDELAKGKDAKPMKLGFTFSYPVDQTSLNSGTLIRW
TKGFRIADTVGKDVVQLYQEQLSAQGMPMIKVVALTNDTVGTYLSHCYTSDNTDSMTSGE
ISEPVIGCIFGTGTNGCYMEEINKITKLPQELRDKLIKEGKTHMIINVEWGSFDNELKHL
PTTKYDVVIDQKLSTNPGFHLFEKRVSGMFLGEVLRNILVDLHSQGLLLQQYRSKEQLPR
HLTTPFQLSSEVLSHIEIDDSTGLRETELSLLQSLRLPTTPTERVQIQKLVRAISRRSAY
LAAVPLAAILIKTNALNKRYHGEVEIGCDGSVVEYYPGFRSMLRHALALSPLGAEGERKV
HLKIAKDGSGVGAALCALVA
Download sequence
Identical sequences C8Z449 N1P652 P17709
YCL040W YCL040W 4932.YCL040W YCL040W YCL040W YCL040W YCL040W YCL040W YCL040W YCL042W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]