SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YCL058W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YCL058W-A   Protein: S000028518
Sequence length 113
Comment YCL058W-A SGDID:S000028518, Chr III from 23584-23925, Uncharacterized ORF, "Protein of unknown function; identified by homology to Ashbya gossypii"
Sequence
MGKCSMKKKGVGKNVGVGKKVQKKRSISTAERKRTKLQVEKLNKSSETMIPTLLREASTQ
EPAKLKAETTLKAEELIKDQEKDSKVREQIRTEKSKTNDSMLKQIEMISGFSL
Download sequence
Identical sequences C8Z432 E7KKQ9 G2W9W9 N1P6A2 Q2V2Q1 W7PPK2 W7RH36
YCL058W-A YCL058W-A 4932.YCL058W-A YCL058W-A YCL058W-A YCL058W-A YCL058W-A YCL058W-A YCL058W-A YCL058W-A YCL058W-A YCL058W-A YCL058W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]