SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YCL058W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YCL058W-A   Protein: S000028518
Sequence length 113
Comment YCL058W-A SGDID:S000028518, Chr III from 23584-23925, Uncharacterized ORF, "Protein of unknown function; identified by homology to Ashbya gossypii"
Sequence
MGKCSMKKKGVGKNVGVGKKVQKKRSISTAERKRTKLQVEKLNKSSETMIPTLLREASTQ
EPAKLKAETTLKAEELIKDQEKDSKVREQIRTEKSKTNDSMLKQIEMISGFSL
Download sequence
Identical sequences C8Z432 E7KKQ9 G2W9W9 N1P6A2 Q2V2Q1 W7PPK2 W7RH36
YCL058W-A YCL058W-A YCL058W-A 4932.YCL058W-A YCL058W-A YCL058W-A YCL058W-A YCL058W-A YCL058W-A YCL058W-A YCL058W-A YCL058W-A YCL058W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]