SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YCL074W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YCL074W
Domain Number 1 Region: 1-143,168-287
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 6.99e-19
Family Reverse transcriptase 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
DNA polymerase activity 2.118 184.57
nucleotidyltransferase activity 1.506 106.88
nuclease activity 1.579 41.91
endonuclease activity 1.983 12.96
lyase activity 1.395 11.51
chromatin binding 1.601 8.12
damaged DNA binding 2.2 8.02
single-stranded RNA binding 2.032 6.96
Cellular Component IC (bits) H-Score
replication fork 2.17 35.23
protein-DNA complex 1.891 21.34
host intracellular part 1.994 20.15
DNA repair complex 2.082 15.46
transferase complex 1.334 12.79
mitochondrial matrix 1.568 10.28
intracellular ribonucleoprotein complex 1.329 8.81
chromosomal part 1.456 7.08
nuclear chromosome part 1.803 6.1
nuclear periphery 2.216 5.52

Protein sequence

External link(s) Locus: YCL074W   Protein: S000000579
Sequence length 308
Comment YCL074W SGDID:S000000579, Chr III from 2824-3750, pseudogene, "Pseudogene: encodes fragment of Ty Pol protein"
Sequence
MDVDTAFLNSTMDEPIYVKQPPGFVNERNPDYVWELYGGMYGLKQAPLLWNEHINNTLKK
IGFCRHEGEHGLYFRSTSDGPIYIAVYVDDLLVAAPSPKIYDRVKQELTKLYSMKDLGKV
DKFLGLNIHQSSNGDITLSLQDYIAKAASESEINTFKLTQTPLCNSKPLFETTSPHLKDI
TPYQSIVGQLLFCANTGRPDISYPVSLLSRFLREPRAIHLESARRVLRYLYTTRSMCLKY
RSGSQLALTVYCDASHGAIHDLPHSTGGYVTLLAGAPVTWSSKKLKGVIPVPSTEAEYIT
ASETVMEI
Download sequence
Identical sequences A6ZTC3 P25600
YR99 YCL074W tr|A6ZTC3|A6ZTC3_YEAS7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]