SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YCL074W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YCL074W
Domain Number 1 Region: 1-143,168-287
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 6.99e-19
Family Reverse transcriptase 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
DNA polymerase activity 2.239 198.1
nucleotidyltransferase activity 1.652 110.04
nuclease activity 1.722 45.87
RNA binding 1.361 5.79
chromatin binding 1.686 5
exonuclease activity 1.983 2.89
Cellular Component IC (bits) H-Score
replication fork 2.197 36.94
mitochondrial matrix 1.716 9.32
ribonucleoprotein complex 1.415 7.33
chromosomal part 1.478 7.26
nuclear chromosome 1.723 6.3
nuclear periphery 2.218 5.13

Protein sequence

External link(s) Locus: YCL074W   Protein: S000000579
Sequence length 308
Comment YCL074W SGDID:S000000579, Chr III from 2824-3750, pseudogene, "Pseudogene: encodes fragment of Ty Pol protein"
Sequence
MDVDTAFLNSTMDEPIYVKQPPGFVNERNPDYVWELYGGMYGLKQAPLLWNEHINNTLKK
IGFCRHEGEHGLYFRSTSDGPIYIAVYVDDLLVAAPSPKIYDRVKQELTKLYSMKDLGKV
DKFLGLNIHQSSNGDITLSLQDYIAKAASESEINTFKLTQTPLCNSKPLFETTSPHLKDI
TPYQSIVGQLLFCANTGRPDISYPVSLLSRFLREPRAIHLESARRVLRYLYTTRSMCLKY
RSGSQLALTVYCDASHGAIHDLPHSTGGYVTLLAGAPVTWSSKKLKGVIPVPSTEAEYIT
ASETVMEI
Download sequence
Identical sequences A6ZTC3 P25600
YCL074W YR99 tr|A6ZTC3|A6ZTC3_YEAS7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]