SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YCL074W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YCL074W
Domain Number 1 Region: 1-143,168-287
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 6.99e-19
Family Reverse transcriptase 0.028
Further Details:      
 

Protein sequence

External link(s) Locus: YCL074W   Protein: S000000579
Sequence length 308
Comment YCL074W SGDID:S000000579, Chr III from 2824-3750, pseudogene, "Pseudogene: encodes fragment of Ty Pol protein"
Sequence
MDVDTAFLNSTMDEPIYVKQPPGFVNERNPDYVWELYGGMYGLKQAPLLWNEHINNTLKK
IGFCRHEGEHGLYFRSTSDGPIYIAVYVDDLLVAAPSPKIYDRVKQELTKLYSMKDLGKV
DKFLGLNIHQSSNGDITLSLQDYIAKAASESEINTFKLTQTPLCNSKPLFETTSPHLKDI
TPYQSIVGQLLFCANTGRPDISYPVSLLSRFLREPRAIHLESARRVLRYLYTTRSMCLKY
RSGSQLALTVYCDASHGAIHDLPHSTGGYVTLLAGAPVTWSSKKLKGVIPVPSTEAEYIT
ASETVMEI
Download sequence
Identical sequences A6ZTC3 P25600
YCL074W YR99 tr|A6ZTC3|A6ZTC3_YEAS7

Jump to [ Top of page · Domain architecture · Domain assignment details ]