SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YCL074W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YCL074W
Domain Number 1 Region: 1-143,168-287
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 6.99e-19
Family Reverse transcriptase 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
replication fork 2.213 35.44
protein-DNA complex 1.923 21
host cell part 1.996 16.84
DNA repair complex 2.125 15.62
transferase complex 1.369 13.17
mitochondrial matrix 1.611 10.47
intracellular ribonucleoprotein complex 1.368 10.44
chromosomal part 1.512 7.06
nuclear chromosome part 1.842 6.12
chromosomal region 1.996 5.49

Protein sequence

External link(s) Locus: YCL074W   Protein: S000000579
Sequence length 308
Comment YCL074W SGDID:S000000579, Chr III from 2824-3750, pseudogene, "Pseudogene: encodes fragment of Ty Pol protein"
Sequence
MDVDTAFLNSTMDEPIYVKQPPGFVNERNPDYVWELYGGMYGLKQAPLLWNEHINNTLKK
IGFCRHEGEHGLYFRSTSDGPIYIAVYVDDLLVAAPSPKIYDRVKQELTKLYSMKDLGKV
DKFLGLNIHQSSNGDITLSLQDYIAKAASESEINTFKLTQTPLCNSKPLFETTSPHLKDI
TPYQSIVGQLLFCANTGRPDISYPVSLLSRFLREPRAIHLESARRVLRYLYTTRSMCLKY
RSGSQLALTVYCDASHGAIHDLPHSTGGYVTLLAGAPVTWSSKKLKGVIPVPSTEAEYIT
ASETVMEI
Download sequence
Identical sequences A0A0L8VLL2 A6ZTC3 P25600
YCL074W YR99 tr|A6ZTC3|A6ZTC3_YEAS7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]