SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YCL075W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YCL075W   Protein: S000000580
Sequence length 146
Comment YCL075W SGDID:S000000580, Chr III from 2126-2566, pseudogene, "Pseudogene: encodes fragment of Ty Pol protein"
Sequence
MYIIYGADHRISNCSLLKRRIPEARIFKLYPNDKTSRSSSASVAIPDYETQGQTAGQITP
KSWLCMLSSTVPATKSSEWIFDTGCTSHMCHDRSIFSSFTRSSRKDFVRGVGGSIPIMGS
GTVNIGTVQLHDVSYVPDLPVNLISV
Download sequence
Identical sequences A6ZTC2 H0GCZ4 P25601 W7RDK8
YCL075W tr|A6ZTC2|A6ZTC2_YEAS7 YTYst189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]