SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YCL075W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YCL075W   Protein: S000000580
Sequence length 146
Comment YCL075W SGDID:S000000580, Chr III from 2126-2566, pseudogene, "Pseudogene: encodes fragment of Ty Pol protein"
Sequence
MYIIYGADHRISNCSLLKRRIPEARIFKLYPNDKTSRSSSASVAIPDYETQGQTAGQITP
KSWLCMLSSTVPATKSSEWIFDTGCTSHMCHDRSIFSSFTRSSRKDFVRGVGGSIPIMGS
GTVNIGTVQLHDVSYVPDLPVNLISV
Download sequence
Identical sequences A6ZTC2 H0GCZ4 P25601 W7RDK8
YCL075W YTYst189 tr|A6ZTC2|A6ZTC2_YEAS7

Jump to [ Top of page · Domain architecture · Domain assignment details ]