SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YCR021C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YCR021C
Domain Number 1 Region: 26-273
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.48e-52
Family Bacteriorhodopsin-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
integral component of plasma membrane 1.37 73.04
non-motile cilium 2.148 26.66
cell projection membrane 1.792 25.55
cilium 1.637 16.48
ciliary part 1.792 13.67
receptor complex 1.408 10.05
cell body 1.528 8.65
plasma membrane receptor complex 1.761 7.38
endosome 1.318 6.95
secretory vesicle 1.533 6.44

Protein sequence

External link(s) Locus: YCR021C   Protein: S000000615
Sequence length 332
Comment HSP30 SGDID:S000000615, Chr III from 157103-156105, reverse complement, Verified ORF, "Hydrophobic plasma membrane localized, stress-responsive protein that negatively regulates the H(+)-ATPase Pma1p; induced by heat shock, ethanol treatment, weak organic acid, glucose limitation, and entry into stationary phase"
Sequence
MNDTLSSFLNRNEALGLNPPHGLDMHITKRGSDWLWAVFAVFGFILLCYVVMFFIAENKG
SRLTRYALAPAFLITFFEFFAFFTYASDLGWTGVQAEFNHVKVSKSITGEVPGIRQIFYS
KYIAWFLSWPCLLFLIELAASTTGENDDISALDMVHSLLIQIVGTLFWVVSLLVGSLIKS
TYKWGYYTIGAVAMLVTQGVICQRQFFNLKTRGFNALMLCTCMVIVWLYFICWGLSDGGN
RIQPDGEAIFYGVLDLCVFAIYPCYLLIAVSRDGKLPRLSLTGGFSHHHATDDVEDAAPE
TKEAVPESPRASGETAIHEPEPEAEQAVEDTA
Download sequence
Identical sequences A6ZTK3 B3LU93 C7GW74 N1P7V1 P25619
YCR021C 2222S YCR021C YCR021C YCR021C YCR021C YCR021C YCR021C tr|A6ZTK3|A6ZTK3_YEAS7 SCRT_05422 YCR021C YCR021C 4932.YCR021C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]