SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YCR021C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YCR021C
Domain Number 1 Region: 26-273
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.48e-52
Family Bacteriorhodopsin-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
integral component of plasma membrane 1.462 75.1
cell projection membrane 1.523 29.51
nonmotile primary cilium 1.962 29.51
cilium 1.573 13.54
dendrite 1.585 9.74
receptor complex 1.511 9.51
endosome 1.323 8.48
cytoplasmic vesicle part 1.73 6.45
intrinsic component of organelle membrane 2.09 6.45
ciliary part 1.844 6.09

Protein sequence

External link(s) Locus: YCR021C   Protein: S000000615
Sequence length 332
Comment HSP30 SGDID:S000000615, Chr III from 157103-156105, reverse complement, Verified ORF, "Hydrophobic plasma membrane localized, stress-responsive protein that negatively regulates the H(+)-ATPase Pma1p; induced by heat shock, ethanol treatment, weak organic acid, glucose limitation, and entry into stationary phase"
Sequence
MNDTLSSFLNRNEALGLNPPHGLDMHITKRGSDWLWAVFAVFGFILLCYVVMFFIAENKG
SRLTRYALAPAFLITFFEFFAFFTYASDLGWTGVQAEFNHVKVSKSITGEVPGIRQIFYS
KYIAWFLSWPCLLFLIELAASTTGENDDISALDMVHSLLIQIVGTLFWVVSLLVGSLIKS
TYKWGYYTIGAVAMLVTQGVICQRQFFNLKTRGFNALMLCTCMVIVWLYFICWGLSDGGN
RIQPDGEAIFYGVLDLCVFAIYPCYLLIAVSRDGKLPRLSLTGGFSHHHATDDVEDAAPE
TKEAVPESPRASGETAIHEPEPEAEQAVEDTA
Download sequence
Identical sequences A6ZTK3 B3LU93 C7GW74 N1P7V1 P25619
YCR021C YCR021C YCR021C YCR021C YCR021C YCR021C tr|A6ZTK3|A6ZTK3_YEAS7 YCR021C YCR021C 2222S YCR021C SCRT_05422 4932.YCR021C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]