SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YCR021C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YCR021C
Domain Number 1 Region: 26-273
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.48e-52
Family Bacteriorhodopsin-like 0.0024
Further Details:      
 

Protein sequence

External link(s) Locus: YCR021C   Protein: S000000615
Sequence length 332
Comment HSP30 SGDID:S000000615, Chr III from 157103-156105, reverse complement, Verified ORF, "Hydrophobic plasma membrane localized, stress-responsive protein that negatively regulates the H(+)-ATPase Pma1p; induced by heat shock, ethanol treatment, weak organic acid, glucose limitation, and entry into stationary phase"
Sequence
MNDTLSSFLNRNEALGLNPPHGLDMHITKRGSDWLWAVFAVFGFILLCYVVMFFIAENKG
SRLTRYALAPAFLITFFEFFAFFTYASDLGWTGVQAEFNHVKVSKSITGEVPGIRQIFYS
KYIAWFLSWPCLLFLIELAASTTGENDDISALDMVHSLLIQIVGTLFWVVSLLVGSLIKS
TYKWGYYTIGAVAMLVTQGVICQRQFFNLKTRGFNALMLCTCMVIVWLYFICWGLSDGGN
RIQPDGEAIFYGVLDLCVFAIYPCYLLIAVSRDGKLPRLSLTGGFSHHHATDDVEDAAPE
TKEAVPESPRASGETAIHEPEPEAEQAVEDTA
Download sequence
Identical sequences A6ZTK3 B3LU93 C7GW74 P25619
YCR021C 4932.YCR021C YCR021C YCR021C SCRT_05422 YCR021C YCR021C tr|A6ZTK3|A6ZTK3_YEAS7 YCR021C 2222S YCR021C YCR021C YCR021C

Jump to [ Top of page · Domain architecture · Domain assignment details ]