SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YCR039C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YCR039C
Domain Number 1 Region: 131-198
Classification Level Classification E-value
Superfamily Homeodomain-like 2.27e-16
Family Homeodomain 3.03e-05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
transcription factor complex 1.881 44.01
nucleoplasm part 1.419 35.1
SWI/SNF superfamily-type complex 2.177 21.83
chromosomal part 1.478 14.27
microtubule cytoskeleton 1.333 5.78
centrosome 1.805 5.78
nuclear chromosome 1.723 5.28
condensed chromosome 2.187 4.2
Biological Process IC (bits) H-Score
cell fate specification 2.061 47.45
cell fate commitment 1.398 44.93
neuron fate commitment 2.075 36.36
diencephalon development 2.12 36.11
embryonic skeletal system development 1.617 35.63
spinal cord development 2.207 32.64
gastrulation 1.44 32.25
mesoderm formation 1.807 32.25
RNA biosynthetic process 1.536 29.57
axis specification 1.743 26.82

Protein sequence

External link(s) Locus: YCR039C   Protein: S000000635
Sequence length 210
Comment MATALPHA2 SGDID:S000000635, Chr III from 200174-199542, reverse complement, Verified ORF, "Homeobox-domain protein that, with Mcm1p, represses a-specific genes in haploids; acts with A1p to repress transcription of haploid-specific genes in diploids; one of two genes encoded by the MATalpha mating type cassette"
Sequence
MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR
ANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSNYQLTQKNKSADGLVFNVVT
QDMINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWV
SNRRRKEKTITIAPELADLLSGEPLAKKKE
Download sequence
Identical sequences A6ZTM1 B3LU20 C8Z424 E7KA47 E7KKQ4 G2WA57 H0GD51 P0CY08 P0CY09
ORFP:2768 YCL067C YCR039C YCL067C ORFP:2769 YCL067C YCR039C ORFP:2266 YCL067C YCR039C YCL067C YCR039C YCL067C YCR039C YCL067C YCR039C YCL067C YCR039C YCL067C YCR039C YCL067C YCR039C 4932.YCL067C 4932.YCR039C YCL067C YCR039C SCRT_05346 YCL067C YCR039C tr|A6ZTM1|A6ZTM1_YEAS7 YCL067C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]