SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YCR039C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YCR039C
Domain Number 1 Region: 131-198
Classification Level Classification E-value
Superfamily Homeodomain-like 2.27e-16
Family Homeodomain 3.03e-05
Further Details:      
 

Protein sequence

External link(s) Locus: YCR039C   Protein: S000000635
Sequence length 210
Comment MATALPHA2 SGDID:S000000635, Chr III from 200174-199542, reverse complement, Verified ORF, "Homeobox-domain protein that, with Mcm1p, represses a-specific genes in haploids; acts with A1p to repress transcription of haploid-specific genes in diploids; one of two genes encoded by the MATalpha mating type cassette"
Sequence
MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR
ANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSNYQLTQKNKSADGLVFNVVT
QDMINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWV
SNRRRKEKTITIAPELADLLSGEPLAKKKE
Download sequence
Identical sequences A6ZTM1 B3LU20 C8Z424 E7KA47 E7KKQ4 G2WA57 H0GD51 P0CY08 P0CY09
ORFP:2768 YCL067C YCR039C YCL067C ORFP:2769 YCL067C YCR039C ORFP:2266 YCL067C YCR039C YCL067C YCR039C YCL067C YCR039C YCL067C YCR039C YCL067C YCR039C YCL067C YCR039C YCL067C YCR039C 4932.YCL067C 4932.YCR039C YCL067C YCR039C SCRT_05346 YCL067C YCR039C tr|A6ZTM1|A6ZTM1_YEAS7 YCL067C

Jump to [ Top of page · Domain architecture · Domain assignment details ]