SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YCR039C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YCR039C
Domain Number 1 Region: 131-198
Classification Level Classification E-value
Superfamily Homeodomain-like 2.27e-16
Family Homeodomain 0.0000303
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
protein-DNA complex 1.923 18.12
chromosomal part 1.512 12.74
nucleoplasm part 1.369 11.17
ATPase complex 2.002 11.05
nuclear transcription factor complex 2.016 8.32
chromosomal region 1.996 7.51
transferase complex 1.369 7.08
microtubule cytoskeleton 1.44 5.46
centrosome 2.023 5.46
nuclear chromosome part 1.842 4.92
Biological Process IC (bits) H-Score
endocrine system development 1.681 40.61
cell fate specification 1.993 36.66
cell fate commitment 1.4 33.46
diencephalon development 2.237 30.86
forebrain development 1.469 29.05
endocrine pancreas development 1.998 28.42
pancreas development 1.741 26.94
regulation of cell fate commitment 2.15 24.05
gastrulation 1.536 23.99
regulation of apoptotic process 1.258 22.83

Protein sequence

External link(s) Locus: YCR039C   Protein: S000000635
Sequence length 210
Comment MATALPHA2 SGDID:S000000635, Chr III from 200174-199542, reverse complement, Verified ORF, "Homeobox-domain protein that, with Mcm1p, represses a-specific genes in haploids; acts with A1p to repress transcription of haploid-specific genes in diploids; one of two genes encoded by the MATalpha mating type cassette"
Sequence
MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR
ANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSNYQLTQKNKSADGLVFNVVT
QDMINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWV
SNRRRKEKTITIAPELADLLSGEPLAKKKE
Download sequence
Identical sequences A0A0L8RMC5 A0A0L8VVV9 A6ZTM1 B3LU20 C8Z424 E7KA47 E7KKQ4 G2WA57 H0GD51 P0CY08 P0CY09
YCR039C YCL067C YCL067C YCR039C tr|A6ZTM1|A6ZTM1_YEAS7 4932.YCL067C 4932.YCR039C SCRT_05346 ORFP:2266 YCL067C YCR039C YCL067C YCR039C YCL067C YCR039C ORFP:2768 YCL067C YCR039C YCL067C YCR039C YCL067C ORFP:2769 YCL067C YCR039C YCL067C YCL067C YCR039C YCL067C YCR039C YCL067C YCR039C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]