SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YCR045W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YCR045W-A   Protein: S000028607
Sequence length 116
Comment YCR045W-A SGDID:S000028607, Chr III from 208747-209097, Dubious ORF, "Dubious ORF unlikely to encode a protein, based on available experimental and comparative sequence data; completely overlaps with YCR045C; identified by gene-trapping, microarray expression analysis, and genome-wide homology searching"
Sequence
MAPSTAMLIMGLLKLPRLRLATHFLPCGRLTFVQCSTMNSRPLRTLLASPDPSLPKTLTS
TRLTLFAAPYVLEPTSPATCVPWPFWSPNPSLVKSIPWMTLSSNSGWSAKIPVSMI
Download sequence
Identical sequences C8Z4D6 Q8TGQ2
YCR045W-A YCR045W-A YCR045W-A YCR045W-A YCR045W-A YCR045W-A YCR045W-A YCR045W-A YCR045W-A YCR045W-A YCR045W-A YCR045W-A YCR045W-A 4932.YCR045W-A YCR045W-A YCR045W-A YCR045W-A YCR045W-A YCR045W-A YCR045W-A YCR045W-A YCR045W-A YCR045W-A YCR045W-A YCR045W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]