SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YCR045W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YCR045W-A   Protein: S000028607
Sequence length 116
Comment YCR045W-A SGDID:S000028607, Chr III from 208747-209097, Dubious ORF, "Dubious ORF unlikely to encode a protein, based on available experimental and comparative sequence data; completely overlaps with YCR045C; identified by gene-trapping, microarray expression analysis, and genome-wide homology searching"
Sequence
MAPSTAMLIMGLLKLPRLRLATHFLPCGRLTFVQCSTMNSRPLRTLLASPDPSLPKTLTS
TRLTLFAAPYVLEPTSPATCVPWPFWSPNPSLVKSIPWMTLSSNSGWSAKIPVSMI
Download sequence
Identical sequences C8Z4D6 Q8TGQ2
YCR045W-A YCR045W-A YCR045W-A YCR045W-A YCR045W-A YCR045W-A YCR045W-A YCR045W-A YCR045W-A YCR045W-A YCR045W-A YCR045W-A YCR045W-A 4932.YCR045W-A YCR045W-A YCR045W-A YCR045W-A YCR045W-A YCR045W-A YCR045W-A YCR045W-A YCR045W-A YCR045W-A YCR045W-A YCR045W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]