SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YCR057C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YCR057C
Domain Number 1 Region: 184-222,250-548
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.56e-74
Family WD40-repeat 0.00019
Further Details:      
 
Domain Number 2 Region: 20-221
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.56e-32
Family WD40-repeat 0.00076
Further Details:      
 
Domain Number 3 Region: 516-642,676-702
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.73e-11
Family Quinoprotein alcohol dehydrogenase-like 0.055
Further Details:      
 

Protein sequence

External link(s) Locus: YCR057C   Protein: S000000653
Sequence length 923
Comment PWP2 SGDID:S000000653, Chr III from 223224-220453, reverse complement, Verified ORF, "Conserved 90S pre-ribosomal component essential for proper endonucleolytic cleavage of the 35 S rRNA precursor at A0, A1, and A2 sites; contains eight WD-repeats; PWP2 deletion leads to defects in cell cycle and bud morphogenesis"
Sequence
MKSDFKFSNLLGTVYRQGNITFSDDGKQLLSPVGNRVSVFDLINNKSFTFEYEHRKNIAA
IDLNKQGTLLISIDEDGRAILVNFKARNVLHHFNFKEKCSAVKFSPDGRLFALASGRFLQ
IWKTPDVNKDRQFAPFVRHRVHAGHFQDITSLTWSQDSRFILTTSKDLSAKIWSVDSEEK
NLAATTFNGHRDYVMGAFFSHDQEKIYTVSKDGAVFVWEFTKRPSDDDDNESEDDDKQEE
VDISKYSWRITKKHFFYANQAKVKCVTFHPATRLLAVGFTSGEFRLYDLPDFTLIQQLSM
GQNPVNTVSVNQTGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDSTNSLAYSPDGSRV
VTASEDGKIKVWDITSGFCLATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIRYR
NFRTFTGTERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDALSGHEGPVSCLS
FSQENSVLASASWDKTIRIWSIFGRSQQVEPIEVYSDVLALSMRPDGKEVAVSTLKGQIS
IFNIEDAKQVGNIDCRKDIISGRFNQDRFTAKNSERSKFFTTIHYSFDGMAIVAGGNNNS
ICLYDVPNEVLLKRFIVSRNMALNGTLEFLNSKKMTEAGSLDLIDDAGENSDLEDRIDNS
LPGSQRGGDLSTRKMRPEVRVTSVQFSPTANAFAAASTEGLLIYSTNDTILFDPFDLDVD
VTPHSTVEALREKQFLNALVMAFRLNEEYLINKVYEAIPIKEIPLVASNIPAIYLPRILK
FIGDFAIESQHIEFNLIWIKALLSASGGYINEHKYLFSTAMRSIQRFIVRVAKEVVNTTT
DNKYTYRFLVSTDGSMEDGAADDDEVLLKDDADEDNEENEENDVVMESDDEEGWIGFNGK
DNKLPLSNENDSSDEEENEKELP
Download sequence
Identical sequences P25635
YCR057C 4932.YCR057C YCR057C YCR057C YCR057c___KOG0291 YCR057C YCR057C

Jump to [ Top of page · Domain architecture · Domain assignment details ]