SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YCR057C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YCR057C
Domain Number 1 Region: 184-222,250-548
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.56e-74
Family WD40-repeat 0.00019
Further Details:      
 
Domain Number 2 Region: 20-221
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.56e-32
Family WD40-repeat 0.00076
Further Details:      
 
Domain Number 3 Region: 516-642,676-702
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000000373
Family Quinoprotein alcohol dehydrogenase-like 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
cullin-RING ubiquitin ligase complex 2.116 52.17
transferase complex 1.369 36.23
organelle envelope 1.405 25.6
dendrite 1.582 21.69
methyltransferase complex 2.143 21.65
cilium 1.675 18.56
endoplasmic reticulum subcompartment 1.59 15.9
nuclear transcription factor complex 2.016 13.21
membrane coat 2.044 11.36
endosome 1.351 9.77
Biological Process IC (bits) H-Score
regulation of organ morphogenesis 1.683 29.68
kidney development 1.515 26.51
digestive tract development 2.033 24.08
rRNA metabolic process 2.071 23.36
cilium assembly 1.378 22.22
mRNA metabolic process 1.678 19.27
mRNA processing 1.845 19.27
response to topologically incorrect protein 2.004 18.29
RNA processing 1.499 17.76
telomere organization 2.237 16.58

Protein sequence

External link(s) Locus: YCR057C   Protein: S000000653
Sequence length 923
Comment PWP2 SGDID:S000000653, Chr III from 223224-220453, reverse complement, Verified ORF, "Conserved 90S pre-ribosomal component essential for proper endonucleolytic cleavage of the 35 S rRNA precursor at A0, A1, and A2 sites; contains eight WD-repeats; PWP2 deletion leads to defects in cell cycle and bud morphogenesis"
Sequence
MKSDFKFSNLLGTVYRQGNITFSDDGKQLLSPVGNRVSVFDLINNKSFTFEYEHRKNIAA
IDLNKQGTLLISIDEDGRAILVNFKARNVLHHFNFKEKCSAVKFSPDGRLFALASGRFLQ
IWKTPDVNKDRQFAPFVRHRVHAGHFQDITSLTWSQDSRFILTTSKDLSAKIWSVDSEEK
NLAATTFNGHRDYVMGAFFSHDQEKIYTVSKDGAVFVWEFTKRPSDDDDNESEDDDKQEE
VDISKYSWRITKKHFFYANQAKVKCVTFHPATRLLAVGFTSGEFRLYDLPDFTLIQQLSM
GQNPVNTVSVNQTGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDSTNSLAYSPDGSRV
VTASEDGKIKVWDITSGFCLATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIRYR
NFRTFTGTERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDALSGHEGPVSCLS
FSQENSVLASASWDKTIRIWSIFGRSQQVEPIEVYSDVLALSMRPDGKEVAVSTLKGQIS
IFNIEDAKQVGNIDCRKDIISGRFNQDRFTAKNSERSKFFTTIHYSFDGMAIVAGGNNNS
ICLYDVPNEVLLKRFIVSRNMALNGTLEFLNSKKMTEAGSLDLIDDAGENSDLEDRIDNS
LPGSQRGGDLSTRKMRPEVRVTSVQFSPTANAFAAASTEGLLIYSTNDTILFDPFDLDVD
VTPHSTVEALREKQFLNALVMAFRLNEEYLINKVYEAIPIKEIPLVASNIPAIYLPRILK
FIGDFAIESQHIEFNLIWIKALLSASGGYINEHKYLFSTAMRSIQRFIVRVAKEVVNTTT
DNKYTYRFLVSTDGSMEDGAADDDEVLLKDDADEDNEENEENDVVMESDDEEGWIGFNGK
DNKLPLSNENDSSDEEENEKELP
Download sequence
Identical sequences P25635
YCR057C YCR057c___KOG0291 YCR057C YCR057C 4932.YCR057C 5wyj.BA 5wyk.BA YCR057C YCR057C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]