SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YCR057C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YCR057C
Domain Number 1 Region: 184-222,250-548
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.56e-74
Family WD40-repeat 0.00019
Further Details:      
 
Domain Number 2 Region: 20-221
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.56e-32
Family WD40-repeat 0.00076
Further Details:      
 
Domain Number 3 Region: 516-642,676-702
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.73e-11
Family Quinoprotein alcohol dehydrogenase-like 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ubiquitin ligase complex 1.933 42.51
nucleolus 1.652 36.88
methyltransferase complex 2.218 18.65
cilium 1.611 16.73
vacuole 1.428 11.94
nucleoplasm part 1.418 11.42
transcription factor complex 1.882 11.42
nuclear outer membrane-endoplasmic reticulum membrane network 1.559 11.38
cytoplasmic vesicle part 1.738 10.37
cytoplasmic vesicle membrane 1.923 10.37

Protein sequence

External link(s) Locus: YCR057C   Protein: S000000653
Sequence length 923
Comment PWP2 SGDID:S000000653, Chr III from 223224-220453, reverse complement, Verified ORF, "Conserved 90S pre-ribosomal component essential for proper endonucleolytic cleavage of the 35 S rRNA precursor at A0, A1, and A2 sites; contains eight WD-repeats; PWP2 deletion leads to defects in cell cycle and bud morphogenesis"
Sequence
MKSDFKFSNLLGTVYRQGNITFSDDGKQLLSPVGNRVSVFDLINNKSFTFEYEHRKNIAA
IDLNKQGTLLISIDEDGRAILVNFKARNVLHHFNFKEKCSAVKFSPDGRLFALASGRFLQ
IWKTPDVNKDRQFAPFVRHRVHAGHFQDITSLTWSQDSRFILTTSKDLSAKIWSVDSEEK
NLAATTFNGHRDYVMGAFFSHDQEKIYTVSKDGAVFVWEFTKRPSDDDDNESEDDDKQEE
VDISKYSWRITKKHFFYANQAKVKCVTFHPATRLLAVGFTSGEFRLYDLPDFTLIQQLSM
GQNPVNTVSVNQTGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDSTNSLAYSPDGSRV
VTASEDGKIKVWDITSGFCLATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIRYR
NFRTFTGTERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDALSGHEGPVSCLS
FSQENSVLASASWDKTIRIWSIFGRSQQVEPIEVYSDVLALSMRPDGKEVAVSTLKGQIS
IFNIEDAKQVGNIDCRKDIISGRFNQDRFTAKNSERSKFFTTIHYSFDGMAIVAGGNNNS
ICLYDVPNEVLLKRFIVSRNMALNGTLEFLNSKKMTEAGSLDLIDDAGENSDLEDRIDNS
LPGSQRGGDLSTRKMRPEVRVTSVQFSPTANAFAAASTEGLLIYSTNDTILFDPFDLDVD
VTPHSTVEALREKQFLNALVMAFRLNEEYLINKVYEAIPIKEIPLVASNIPAIYLPRILK
FIGDFAIESQHIEFNLIWIKALLSASGGYINEHKYLFSTAMRSIQRFIVRVAKEVVNTTT
DNKYTYRFLVSTDGSMEDGAADDDEVLLKDDADEDNEENEENDVVMESDDEEGWIGFNGK
DNKLPLSNENDSSDEEENEKELP
Download sequence
Identical sequences P25635
YCR057C 4932.YCR057C YCR057C YCR057C YCR057c___KOG0291 YCR057C YCR057C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]